11. Reset and clock control (RCC)

11.1 RCC introduction

The reset and clock control (RCC) manages the different kind of reset, and generates all clocks for the bus and peripherals.

11.2 RCC pins and internal signals

The table below lists the RCC inputs and output signals connected to package pins or balls.

Table 112. RCC input/output signals connected to package pins or balls

Signal nameSignal typeDescription
NRSTI/OSystem reset, can be used to provide reset to external devices
OSC32_INI32 kHz oscillator input
OSC32_OUTO32 kHz oscillator output
OSC_INISystem oscillator input
OSC_OUTOSystem oscillator output
MCOOOutput clock for external devices
LSCOOLow-speed output clock for external devices
AUDIOCLKIExternal kernel clock input for SAI1, SAI2, MDF1 and ADF1

11.3 RCC reset functional description

There are three types of reset:

11.3.1 Power reset

A power reset is generated when one of the following events occurs:

A BOR sets all registers to their reset values except the ones in the backup domain.

When exiting Standby mode, all registers in the core domain are set to their reset value. Registers outside the core domain (RTC, TAMP, WKUP, IWDG, and Standby/Shutdown mode control) are not impacted.

When exiting Shutdown mode, a brownout reset is generated, resetting all registers except those in the backup domain.

11.3.2 System reset

A system reset sets all registers to their reset values except the reset flags in RCC_CSR, and the registers in the backup domain.

A system reset is generated when one of the following events occurs:

The reset source can be identified by checking the reset flags in RCC_CSR.

These sources act on the NRST pin and this pin is always kept low during the delay phase. The reset service routine vector is selected via the boot option bytes.

The system reset signal provided to the device is output on the NRST pin. The pulse generator guarantees a minimum reset pulse duration of 20 µs for each internal reset source. In case of an external reset, the reset pulse is generated while the NRST pin is asserted low.

In case of an internal reset, the internal pull-up \( R_{PU} \) is deactivated in order to save the power consumption through the pull-up resistor.

Figure 37. Simplified diagram of the reset circuit

Simplified diagram of the reset circuit. The diagram shows the NRST pin connected to an external reset source and an internal pull-up resistor (Rpu) connected to VDD. The NRST pin is also connected to a filter and a pulse generator (min 20 µs). The filter output is connected to an OR gate, which also receives inputs from WWDG reset, IWDG reset, Software reset, Low-power manager reset, Option-byte loader reset, and BOR. The output of the OR gate is the System reset signal. The pulse generator output is connected to another OR gate, which also receives inputs from the same six internal reset sources. The output of this second OR gate is also the System reset signal. The diagram is labeled MSV69133V1.
Simplified diagram of the reset circuit. The diagram shows the NRST pin connected to an external reset source and an internal pull-up resistor (Rpu) connected to VDD. The NRST pin is also connected to a filter and a pulse generator (min 20 µs). The filter output is connected to an OR gate, which also receives inputs from WWDG reset, IWDG reset, Software reset, Low-power manager reset, Option-byte loader reset, and BOR. The output of the OR gate is the System reset signal. The pulse generator output is connected to another OR gate, which also receives inputs from the same six internal reset sources. The output of this second OR gate is also the System reset signal. The diagram is labeled MSV69133V1.

Software reset

The SYSRESETREQ bit in Cortex-M33 application interrupt and reset control register must be set to force a software reset on the device.

Low-power mode security reset

To avoid that critical applications mistakenly enter a low-power mode, the following low-power mode security resets are available. If enabled in option bytes, the resets are generated in any of the following conditions:

For further information on the user option bytes, refer to Section 7.4.1: Option bytes description .

Option byte loader reset

The option byte loader reset is generated when the OBL_LAUNCH bit is set in the FLASH_NSCR register. This bit is used to launch the option byte loading by software.

11.3.3 Backup domain reset

The backup domain has two specific resets.

A backup domain reset is generated when one of the following events occurs:

A backup domain reset affects the LSE oscillator, the RTC, the TAMP, the backup registers, RCC_BDCR, and PWR_BDCR1. The reset of PWR_BDCR1 affects the backup SRAM. Backup domain reset caused by power on resets SRAM2 to zero as it is corresponding to a tamper policy.

11.4 RCC clock functional description

Four different clock sources can be used to drive the system clock (SYSCLK):

The MSIS is used as system clock source after startup from reset, configured at 4 MHz.

The devices have the following additional clock sources:

Each clock source can be switched on or off independently when it is not used, to optimize power consumption.

Several prescalers can be used to configure the AHB frequency, the APB1, APB2, and APB3 domains. The maximum frequency of the AHB and APB domains is 160 MHz.

All the peripheral clocks are derived from their bus clock (HCLK, PCLK1, PCLK2, or PCLK3) except the following ones that receive an independent kernel clock. This kernel clock can be selected by software between several sources thanks to RCC_CCIPRx registers ( \( x = 1, 2, 3 \) ): OTG_FS, USB, or OTG_HS, SDMMCx ( \( x = 1, 2 \) ), RNG, ADCx ( \( x = 1, 2, 4 \) ), DAC1, U(S)ARTx ( \( x = 1 \) to 6), LPUART1, I2Cx ( \( x = 1 \) to 6), SPIx ( \( x = 1 \) to 3), OCTOSPIx ( \( x = 1, 2 \) ), SAIx ( \( x = 1, 2 \) ), MDF1, ADF1, FDCAN1, LPTIMx ( \( x = 1 \) to 4), SAES, DSI, LTDC, HSPI1.

In addition, the RTC kernel clock is selected by software in RCC_BDCR. The IWDG clock is always the LSI 32 kHz clock.

The RCC feeds the Cortex system timer (SysTick) external clock with the AHB clock (HCLK) divided by eight, or LSE or LSI. The SysTick can work either with this clock or directly with the Cortex clock (HCLK), configurable in the SysTick control and status register.

FCLK acts as Cortex-M33 free-running clock.

Figure 38. Clock tree for STM32U5 series

Detailed clock tree diagram for STM32U5 series showing various clock sources (LSI, LSE, HSE, HSI, MSI) and their distribution through PLLs and prescalers to different system components and peripherals.

The diagram illustrates the clock tree for the STM32U5 series. It shows the following components and connections:

Highlighted connections or peripheral may not be present in all devices of the STM32U5 Series.
Refer to the device datasheet for more information.

MSV71110V4

Detailed clock tree diagram for STM32U5 series showing various clock sources (LSI, LSE, HSE, HSI, MSI) and their distribution through PLLs and prescalers to different system components and peripherals.

11.4.1 HSE clock

The high-speed external clock signal (HSE) can be generated from two possible clock sources:

The resonator and the load capacitors must be placed as close as possible to the oscillator pins in order to minimize output distortion and startup stabilization time. The loading capacitance values must be adjusted according to the selected oscillator.

Figure 39. HSE/ LSE clock sources

Diagram of external clock configuration. A block labeled 'OSC_IN' is connected to an 'External source'. A block labeled 'OSC_OUT' is connected to a 'GPIO'. Diagram of crystal/ceramic resonator configuration. A block labeled 'OSC_IN' is connected to one side of a crystal/resonator symbol. A block labeled 'OSC_OUT' is connected to the other side. A capacitor labeled 'CL1' is connected between 'OSC_IN' and ground. A capacitor labeled 'CL2' is connected between 'OSC_OUT' and ground. The crystal/resonator symbol is labeled 'Load capacitors'.
Clock sourceHardware configuration
External clock
Crystal/ceramic resonators
Diagram of external clock configuration. A block labeled 'OSC_IN' is connected to an 'External source'. A block labeled 'OSC_OUT' is connected to a 'GPIO'. Diagram of crystal/ceramic resonator configuration. A block labeled 'OSC_IN' is connected to one side of a crystal/resonator symbol. A block labeled 'OSC_OUT' is connected to the other side. A capacitor labeled 'CL1' is connected between 'OSC_IN' and ground. A capacitor labeled 'CL2' is connected between 'OSC_OUT' and ground. The crystal/resonator symbol is labeled 'Load capacitors'.

External crystal/ceramic resonator (HSE crystal)

The 4 to 50 MHz external oscillator has the advantage of producing a very accurate rate on the main clock.

The associated hardware configuration is shown in Figure 39 . Refer to the electrical characteristics section of the datasheet for more details.

HSERDY in RCC_CR indicates if the HSE oscillator is stable or not. At startup, the clock is not released until this bit is set by hardware. An interrupt can be generated if enabled in RCC_CIER.

The HSE crystal can be switched on and off using HSEON in RCC_CR.

External source (HSE bypass)

In this mode, an external clock source must be provided. It can have a frequency of up to 50 MHz. This mode is selected by setting HSEBYP and HSEON in RCC_CR. The external clock signal (square, sinus, or triangle) with ~40-60 % duty cycle depending on the frequency (refer to the datasheet) must drive the OSC_IN pin while the OSC_OUT pin can be used a GPIO (see Figure 39 ).

11.4.2 HSI16 clock

The HSI16 clock signal is generated from an internal 16 MHz RC oscillator.

The HSI16 RC oscillator has the advantage of providing a clock source at low cost (no external components). It also has a faster startup time than the HSE crystal oscillator. However, even with calibration, the frequency is less accurate than an external crystal oscillator or ceramic resonator.

The HSI16 clock can be selected as system clock after wake-up from Stop modes. Refer to Section 11.8.6 . It can also be used as a backup clock source (auxiliary clock) if the HSE crystal oscillator fails. Refer to Section 11.4.11 .

Calibration

The RC oscillator frequencies may vary from one chip to another due to manufacturing process variations, this is why each device is factory calibrated by ST for 1 % accuracy at \( T_A = 25^\circ\text{C} \) .

After reset, the factory calibration value is loaded in HSICAL[7:0] of RCC_ICSCR3.

If the application is subject to voltage or temperature variations, this may affect the RC oscillator speed. The HSI16 frequency can be trimmed in the application using HSITRIM[6:0] in RCC_ICSCR3.

For more details on how to measure the HSI16 frequency variation, refer to Section 11.4.23 .

HSIRDY in RCC_CR indicates if the HSI16 RC is stable or not. At startup, the HSI16 RC output clock is not released until this bit is set by hardware.

The HSI16 RC can be switched on and off using HSION in RCC_CR.

The HSI16 signal can also be used as a backup source (auxiliary clock) if the HSE crystal oscillator fails. Refer to Section 11.4.11 .

11.4.3 MSI (MSIS and MSIK) clocks

The MSI is made of four internal RC oscillators: MSIRC0 at 48 MHz, MSIRC1 at 4 MHz, MSIRC2 at 3.072 MHz, and MSIRC3 at 400 kHz. Each oscillator feeds a prescaler providing a division by 1, 2, 3, or 4. Two output clocks are generated from these divided oscillators: MSIS that can be selected as system clock, and MSIK that can be selected by some peripherals as kernel clock.

Figure 40. MSI block diagram

MSI block diagram showing four internal RC oscillators (MSIRC0, MSIRC1, MSIRC2, MSIRC3) connected to a central switching matrix. Each oscillator has four output paths labeled /1, /2, /3, and /4. The matrix selects between these paths to generate the MSIS and MSIK output signals. MSIRC0 is 48 MHz, MSIRC1 is 4 MHz, MSIRC2 is 3.072 MHz, and MSIRC3 is 400 kHz. The diagram is labeled MSV64329V1.
MSI block diagram showing four internal RC oscillators (MSIRC0, MSIRC1, MSIRC2, MSIRC3) connected to a central switching matrix. Each oscillator has four output paths labeled /1, /2, /3, and /4. The matrix selects between these paths to generate the MSIS and MSIK output signals. MSIRC0 is 48 MHz, MSIRC1 is 4 MHz, MSIRC2 is 3.072 MHz, and MSIRC3 is 400 kHz. The diagram is labeled MSV64329V1.

Refer to datasheet for complete MSI frequency characteristics in MSI-mode and in PLL-mode. MSIS and MSIK frequency ranges can be adjusted by software, by using respectively MSISRANGE[3:0] and MSIKRANGE[3:0] in RCC_ICSCR1, with MSIRGSEL = 1. Sixteen frequency ranges are available, generated from the four internal RCs, as shown in the table below.

Table 113. MSIS and MSIK ranges per internal MSIRCs (PLL_mode disabled) (1)

MSIRC0MSIRC1MSIRC2MSIRC3
Range 0: 48 MHzRange 4: 4 MHzRange 8: 3.072 MHzRange 12: 400 kHz
Range 1: 24 MHzRange 5: 2 MHzRange 9: 1.536 MHzRange 13: 200 kHz
Range 2: 16 MHzRange 6: 1.33 MHzRange 10: 1.024 MHzRange 14: 133 kHz
Range 3: 12 MHzRange 7: 1 MHzRange 11: 0.768 MHzRange 15: 100 kHz

1. Refer to datasheet for complete MSI frequency characteristics in MSI-mode and in PLL-mode.

The MSIS clock is used as system clock after restart from reset, wake-up from Standby, and Shutdown low-power modes. After restart from reset or when exiting Shutdown mode, MSIS and MSIK frequencies are set to their default value 4 MHz. The frequency range at wake-up from Standby mode can be adjusted by software, using respectively MSISSRANGE[3:0] and MSIKSRANGE[3:0] with MSIRGSEL = 0 (refer to RCC_CSR).

The MSIS clock can be selected as system clock after a wake-up from Stop mode (Stop 0, Stop 1, Stop 2, or Stop 3) depending on STOPWUCK in RCC_CR. It can also be used as a backup clock source (auxiliary clock) if the HSE crystal oscillator fails. See Section 11.4.11 .

The MSI advantage is to provide a low-cost (no external components) low-power clock source. In addition, when used in PLL-mode with the LSE, the MSI provides a very accurate clock source that can be used by the OTG_FS, or the USB, and feeds the PLL.

MSISRDY and MSIKRDY in RCC_CR indicate whether the MSIS and MSIK RC are stable or not. At startup, MSIS and MSIK RC output clocks are not released until their respective bit is set by hardware. The MSIS and MSIK RC can be switched on and off by using MSISON and MSIKON in RCC_CR.

Hardware auto calibration with LSE (PLL-mode)

When a 32.768 kHz external oscillator is present in the application, it is possible to configure either the MSIS or the MSIK in a PLL-mode. This mode is enabled:

In case MSIS and MSIK ranges are generated from the same MSIRC source, the PLL-mode is applied on both MSIS and MSIK. When configured in PLL-mode, the MSIS or MSIK automatically calibrates itself thanks to the LSE. This mode is available for all MSI frequency ranges. At 48 MHz, the MSIK in PLL-mode can be used for the OTG_FS, or the USB, avoiding the need of an external high-speed crystal.

If LSE clocks pulses are stopped, the MSI PLL-mode is automatically unlocked, and the MSI accuracy is consequently degraded. On all STM32U5 devices except STM32U575/585 rev. X, the MSI PLL-mode unlock event is connected to an EXTI line: this is used to generate an event or interrupt supporting wake-up from Stop 0, Stop 1, or Stop 2 mode (see Table 118: Interrupt sources and control and Table 189: EXTI line connections ).

MSI PLL-mode stabilization time

When MSIPLLEN = 1, the final accuracy after enabling the MSI (by writing MSISON = 1 or MSIKON = 1 or following a peripheral clock request in Stop mode) is reached after a stabilization time \( t_{\text{STAB}}(\text{MSI}) \) when MSIPLLFAST = 0. This stabilization time is needed even if the LSE is kept enable. Refer to datasheet for \( t_{\text{STAB}}(\text{MSI}) \) value.

If MSIPLLEN = 1 with MSIPLLFAST = 1, the MSI oscillator is kept powered on when a request to switch it off is received (either by writing MSISON = 0 and MSIKON = 0, or because no peripheral requests this clock in Stop mode). In this case the MSI PLL-mode accuracy is kept when the MSI is switched on again, providing that the \( t_{\text{STAB}}(\text{MSI}) \) stabilization time is reached before switching off the MSI. This mode can be used for autonomous peripherals requiring accuracy in Stop mode, with an extra consumption as the oscillator remains powered on, but gated off when disabled.

Software calibration

The MSIRCx (x = 0 to 3) oscillators frequency may vary from one chip to another due to manufacturing process variations, this is why each device is factory calibrated by ST for 1 % accuracy at an ambient temperature, \( T_A = 25\text{ }^\circ\text{C} \) . After reset, the factory calibration value is loaded in MSICALx[4:0] (x = 0 to 3) in RCC_ICSCR1. If the application is subject to voltage or temperature variations, this may affect the RC oscillator speed. The MSIRCx frequency can be trimmed in the application by using MSITRIMx[4:0] (x = 0 to 3) in RCC_ICSCR.

Note: The final accuracy after applying the calibration value is reached after a stabilization time. This stabilization time is needed after reset of exiting Standby or Shutdown mode. It is also needed when switching from PLL-mode to normal mode.

The hardware auto calibration with LSE must not be used in conjunction with software calibration.

For more details on how to measure the MSI frequency variation, refer to Section 11.4.23 .

11.4.4 HSI48 clock

The HSI48 clock signal is generated from an internal 48 MHz RC oscillator and can be used directly for USB/OTG_FS, and for the RNG, as well as the SDMMC.

The internal 48 MHz RC oscillator is mainly dedicated to provide a high-precision clock to the OTG_FS and the USB by means of a special clock recovery system (CRS) circuitry. The CRS can use the USB SOF signal (only on STM32U535/545/575/585), the LSE, or an external signal to automatically and quickly adjust the oscillator frequency on-the-fly. It is disabled as soon as the system enters Stop or Standby mode. When the CRS is not used, the HSI48 RC oscillator runs on its default frequency that is subject to manufacturing process variations.

For more details on how to configure and use the CRS peripheral, refer to Section 12: Clock recovery system (CRS) .

The HSI48RDY flag in the RCC_CR register indicates whether the HSI48 RC oscillator is stable or not. At startup, the HSI48 RC oscillator output clock is not released until this bit is set by hardware.

The HSI48 can be switched on and off using the HSI48ON bit in the RCC_CR register.

11.4.5 SHSI clock

The SHSI is an internal securable RC oscillator dedicated to clock the SAES. SHSIRDY flag in RCC_CR indicates if the SHSI RC is stable or not. At startup, the SHSI RC output clock is not released until this bit is set by hardware.

The SHSI RC can be switched on and off using SHSION in RCC_CR.

11.4.6 PLL

The RCC features three PLLs:

The PLLs integrated into the RCC are completely independent. They offer the following features:

The PLLs are controlled via RCC_PLLxDIVR, RCC_PLLxFRACR, RCC_PLLxCFGR, and RCC_CR (x = 1, 2, 3).

The frequency of the reference clock provided to the PLLs (refx_ck) must range from 4 to 16 MHz. The user application must program properly the PLLxM (x = 1, 2, 3) dividers in RCC_PLL1CFGR, RCC_PLL2CFGR, and RCC_PLL3CFGR, in order to match this condition. In addition, PLLxRGE must be set according to the reference input frequency to guarantee an optimal performance of the PLL.

To reduce the power consumption, it is recommended to configure the VCOx output to the lowest frequency.

Figure 41. PLL block diagram

Figure 41. PLL block diagram. The diagram shows the internal architecture of a PLLx. The input 'refx_ck' (4 to 16 MHz) is fed into a 'PFD + CP' block. The 'PFD + CP' block also receives feedback from a divider labeled '÷ 4,5...129...512' (PLLxN). The 'PFD + CP' output goes to an 'LPF' block, which then connects to a 'VCO' block. The VCO output is 'vcxo_ck' (128 to 544 MHz). This output is split into three paths: one through a buffer, and two through AND gates labeled 'PLLxPEN' and 'PLLxREN'. The first AND gate output goes to a divider '÷ 1,2,3...128' (PLLxP) to produce 'pllx_p_ck'. The second AND gate output goes to a divider '÷ 1,2,3...128' (PLLxQ) to produce 'pllx_q_ck'. The third path from the VCO output goes through an AND gate labeled 'PLLxQEN' to a divider '÷ 1,2,3...128' (PLLxR) to produce 'pllx_r_ck'. A 'Sigma-Delta Modulator' block is connected to the VCO and receives inputs 'PLLxFRACEN' and 'PLLxFRACN'. The modulator output goes to an 'SH_REG' block, which then connects to the '÷ 4,5...129...512' (PLLxN) divider. The 'PLLxRGE' input is also shown.
Figure 41. PLL block diagram. The diagram shows the internal architecture of a PLLx. The input 'refx_ck' (4 to 16 MHz) is fed into a 'PFD + CP' block. The 'PFD + CP' block also receives feedback from a divider labeled '÷ 4,5...129...512' (PLLxN). The 'PFD + CP' output goes to an 'LPF' block, which then connects to a 'VCO' block. The VCO output is 'vcxo_ck' (128 to 544 MHz). This output is split into three paths: one through a buffer, and two through AND gates labeled 'PLLxPEN' and 'PLLxREN'. The first AND gate output goes to a divider '÷ 1,2,3...128' (PLLxP) to produce 'pllx_p_ck'. The second AND gate output goes to a divider '÷ 1,2,3...128' (PLLxQ) to produce 'pllx_q_ck'. The third path from the VCO output goes through an AND gate labeled 'PLLxQEN' to a divider '÷ 1,2,3...128' (PLLxR) to produce 'pllx_r_ck'. A 'Sigma-Delta Modulator' block is connected to the VCO and receives inputs 'PLLxFRACEN' and 'PLLxFRACN'. The modulator output goes to an 'SH_REG' block, which then connects to the '÷ 4,5...129...512' (PLLxN) divider. The 'PLLxRGE' input is also shown.

PLLxN loop divider must be programmed to achieve the expected frequency at VCO output. In addition, the VCO output range must be respected.

The PLLx operates in integer mode when PLLxFRACEN is 0, and the PLL is enabled with PLLxON. The fractional mode can be enabled at any time by setting PLL1FRACN to the

required value, and subsequently setting PLLxFRACEN from 0 to 1. The \( \Sigma\Delta \) modulator is designed to minimize the jitter impact while allowing very small step frequency adjustments. To update the fractional value, first set PLLxFRACEN to 0 before updating the PLLxFRACN value, and subsequently set PLLxFRACEN to 1. The old PLLxFRACN value is kept used until the new value is activated by setting PLLxFRACEN from 0 to 1. PLLxFRACN must only be updated by software when PLLxFRACEN is 0.

The PLLs can be enabled by setting PLLxON = 1 in RCC_CR. The PLLxRDY bit indicates that the PLL is ready (meaning locked).

Note: Before enabling the PLLs, make sure that the reference frequency (refx_ck) provided to the PLL is stable. The following PLLx parameters cannot be changed once the PLLx is enabled: PLLxSRC, PLLxN, PLLxRGE, PLLxP, PLLxQ, and PLLxR.

The hardware prevents writing PLL1ON to 0 if the PLL1 is currently used to deliver the system clock.

The following PLL parameters cannot be changed once the PLL is enabled: PLLxN, PLLxRGE, PLLxP, PLLxQ, and PLLxR.

To ensure an optimal behavior of the PLL when one of the post-dividers (PLLxP, PLLxQ, or PLLxR) is not used, the application must clear the enable bit (PLLxPEN, PLLxQEN, PLLxREN), and configure the corresponding post-dividers to their minimum value (PLLxR = 0, PLLxP = 0, or PLLxQ = 0).

If the above rules are not respected, the PLL output frequency is not guaranteed.

Output frequency computation

When the PLL operates in integer mode (SH_REG = 0), the VCO frequency ( \( F_{VCO} \) ) is given by the following formula ( \( x = 1, 2, 3 \) ):

\[ F_{VCOx} = F_{refx\_ck} \times PLLxN \]

When the PLL operates in fractional mode (SH_REG \( \neq \) 0), the PLLxN divider must be initialized before enabling the PLLs. However, the PLLxFRACN value can be changed on-the-fly without disturbing the PLL output.

This feature can be used either to generate a specific frequency from any crystal value with a good accuracy, or to fine-tune the frequency on-the-fly.

For each PLL, the VCO frequency is given by the following formula:

\[ F_{VCOx} = F_{refx\_ck} \times \left( PLLxN + \frac{PLLxFRACN}{2^{(13)}} \right) \]

For both integer and fractional mode, the PLL1 output frequency is given by the following formula:

\[ F_{\text{pll}_x\_y\_ck} = (F_{\text{VCO}_x} / (\text{PLL}_x y + 1)) \text{ with } y = P, Q \text{ or } R \]

The PLLs are disabled by hardware:

The fractional information used by the PLL is reset when disabling the PLL.

PLL initialization phase

The following PLL initialization sequence in integer and fractional mode is recommended. The PLLx are supposed to be disabled at the start of the initialization sequence:

  1. 1. Initialize the PLLs registers according to the required frequency.
    • – For integer mode, set PLLxFRACEN to 0 in RCC_PLL1CFGR, RCC_PLL2CFGR, and RCC_PLL3CFGR.
    • – For fractional mode, set PLLxFRACN to the required initial value (FracInitValue), and then set PLLxFRACEN = 1.
  2. 2. Once PLLxON = 1, the application must wait until PLLxRDY = 1. As long as PLLxRDY = 0, PLLxFRACEN must not be altered.
  3. 3. Once PLLxRDY = 1, the PLLx is ready to be used.
  4. 4. If the application intends to tune the PLLx frequency on-the-fly, then:
    1. a) PLLxFRACEN must be set to 0 to update the PLLxFRACN value while keeping the PLL running.
    2. b) Wait at least 3 periods of the PLL reference clock (refx_ck).
    3. c) A new value can be uploaded into PLLxFRACN (FracValue(n)).
    4. d) PLLxFRACEN must be set to 1 to activate the new programed value in PLLxFRACN that is taken into account by the PLL.

Figure 42. PLL initialization flow

Flowchart of PLL initialization for integer and fractional modes.
graph TD
    subgraph IntegerMode [ ]
        direction TB
        I1([PLL enable sequence integer mode]) --> I2[Select clock source
(RCC_PLLxCFGR)
- (PLL_SRC)] I2 --> I3[Init pre-divider (RCC_PLLxCFGR)
- PLLxM] I3 --> I4[PLLx config (RCC_PLLxCFGR)
- PLLxRGE
- PLLxFRACEN = 0
- PLLxPEN, PLLxQEN, PLLxREN
Init PLLx dividers (RCC_PLLxDIVR)
- PLLxN, PLLxP, PLLxQ, PLLxR] I4 --> I5[Enable PLLx (RCC_CR)
- PLLxON = 1] I5 --> I6{PLLxRDY = 1?} I6 -- No --> I5 I6 -- Yes --> I7([Ready for use in integer mode]) end subgraph FractionalMode [ ] direction TB F1([PLL enable sequence fractional mode]) --> F2[Select clock source (RCC_PLLxCFGR)
- (PLL_SRC)] F2 --> F3[Init pre-divider (RCC_PLLxCFGR)
- PLLxM] F3 --> F4[Init fractional value (RCC_PLLxFRACR)
- FRACN= FracInitValue
PLLx config (RCC_PLLxCFGR)
- PLLxRGE
- PLLxFRACEN = 1
- PLLxPEN, PLLxQEN, PLLxREN
Init PLLx dividers (RCC_PLLxDIVR)
- PLLxN, PLLxP, PLLxQ, PLLxR] F4 --> F5[Enable PLLx (RCC_CR)
- PLLxON = 1] F5 --> F6{PLLxRDY = 1?} F6 -- No --> F5 F6 -- Yes --> F7([Ready for use in fractional mode]) end I7 --> F8[Disable fractional mode (RCC_PLLxCFGR)
- PLLxFRACEN = 0
Init fractional value (RCC_PLLxFRACR)
- FRACN= FracValue(n)
Enable fractional mode (RCC_PLLxCFGR)
- PLLxFRACEN = 1] F7 --> F8 F8 --> F9([Ready for use in fractional mode]) style IntegerMode fill:none,stroke:none style FractionalMode fill:none,stroke:none style F3 fill:none,stroke:none style F4 fill:none,stroke:none style F8 fill:none,stroke:none style F9 fill:none,stroke:none style I3 fill:none,stroke:none style I4 fill:none,stroke:none style I7 fill:none,stroke:none style I6 fill:none,stroke:none style I5 fill:none,stroke:none style I2 fill:none,stroke:none style I1 fill:none,stroke:none style F3 fill:none,stroke:none style F4 fill:none,stroke:none style F7 fill:none,stroke:none style F6 fill:none,stroke:none style F5 fill:none,stroke:none style F2 fill:none,stroke:none style F1 fill:none,stroke:none style F8 fill:none,stroke:none style F9 fill:none,stroke:none

The flowchart illustrates the PLL initialization process, starting with two entry points: "PLL enable sequence integer mode" and "PLL enable sequence fractional mode".

Integer Mode Path:

  1. Select clock source (RCC_PLLxCFGR) - (PLL_SRC)
  2. Init pre-divider (RCC_PLLxCFGR) - PLLxM
  3. PLLx config (RCC_PLLxCFGR):
    • - PLLxRGE
    • - PLLxFRACEN = 0
    • - PLLxPEN, PLLxQEN, PLLxREN
    Init PLLx dividers (RCC_PLLxDIVR):
    • - PLLxN, PLLxP, PLLxQ, PLLxR
  4. Enable PLLx (RCC_CR) - PLLxON = 1
  5. Decision: PLLxRDY = 1?
    • If No: Loop back to Enable PLLx.
    • If Yes: Ready for use in integer mode.

Fractional Mode Path:

  1. Select clock source (RCC_PLLxCFGR) - (PLL_SRC)
  2. Init pre-divider (RCC_PLLxCFGR) - PLLxM
  3. Init fractional value (RCC_PLLxFRACR) - FRACN= FracInitValue
  4. PLLx config (RCC_PLLxCFGR):
    • - PLLxRGE
    • - PLLxFRACEN = 1
    • - PLLxPEN, PLLxQEN, PLLxREN
    Init PLLx dividers (RCC_PLLxDIVR):
    • - PLLxN, PLLxP, PLLxQ, PLLxR
  5. Enable PLLx (RCC_CR) - PLLxON = 1
  6. Decision: PLLxRDY = 1?
    • If No: Loop back to Enable PLLx.
    • If Yes: Ready for use in fractional mode.

Value Update on-the-fly:

Both paths lead to a common block for "Value update on-the-fly":

  1. Disable fractional mode (RCC_PLLxCFGR) - PLLxFRACEN = 0
  2. Init fractional value (RCC_PLLxFRACR) - FRACN= FracValue(n)
  3. Enable fractional mode (RCC_PLLxCFGR) - PLLxFRACEN = 1

This sequence results in the system being "Ready for use in fractional mode".

A note indicates that the steps "Init pre-divider", "PLLx config", and "Init PLLx dividers" can be repeated for each PLL.

MSV65659V1

Flowchart of PLL initialization for integer and fractional modes.

Note: When the PLLxRDY goes to 1, it means that the difference between the PLLx output frequency and the target value is lower than \( \pm 2\% \) .

11.4.7 LSE clock

The LSE crystal is a 32.768 kHz low-speed external crystal or ceramic resonator. It has the advantage of providing a low-power but highly accurate clock source to the real-time clock peripheral (RTC) for clock/calendar or other timing functions.

The LSE crystal is switched on and off using LSEON in RCC_BDCR. If the LSE is used by other peripherals or functions than RTC, TAMP, and LSECSS, the LSESYSEN bit must be also be set in RCC_BDCR (refer to LSE when used by peripherals other than RTC/TAMP, and RCC functions ).

The crystal oscillator driving strength is configured using the LSEDRV[1:0] bits, according to crystal specification, to obtain the best compromise between robustness and short startup

time on one side and low-power-consumption on the other side. The LSE drive must be programmed before enabling the LSE.

LSERDY in RCC_BDCR indicates whether the LSE crystal is stable or not. At startup, the LSE crystal output clock signal is not released until this bit is set by hardware. An interrupt can be generated if enabled in RCC_CIER.

External source (LSE bypass)

In this mode, an external clock source must be provided. This mode is selected by setting LSEBYP and LSEON in RCC_BDCR. The external clock signal (square, sinus, or triangle) with ~50 % duty cycle, must drive the OSC32_IN pin while the OSC32_OUT pin can be used as GPIO (see Figure 39 ).

LSE when used by peripherals other than RTC/TAMP, and RCC functions

By default, when enabled, the LSE is sent only to RTC and TAMP (assuming that RTCSEL = 01).

If the LSE is needed for other peripherals (such as peripheral clock or trigger source), or if the LSE is used by an RCC function (such as LSCO, MCO, MSI PLL mode), the sequence below must be done:

  1. 1. Set LSEON in RCC_BDCR, and wait for LSERD = 1 in RCC_BDCR.
  2. 2. Set LSESYSEN = 1 in RCC_BDCR.
  3. 3. Wait for LSESYSRDY = 1 in RCC_BDCR.

The LSE consumption is increased when LSESYSEN = 1.

11.4.8 LSI clock

The LSI RC acts as a low-power clock source that can be kept running in Stop and Standby modes for the independent watchdog (IWDG) and RTC. The clock frequency is either 32 kHz or 250 Hz depending on LSIPREDIV in RCC_BDCR. Setting LSIPREDIV allows a lower consumption (refer to the electrical characteristics section of the datasheet for more details).

When the IWDG is enabled or when the RTC or TAMP is clocked by the LSI, LSIPREDIV cannot be changed anymore.

The LSI RC can be switched on and off using LSION in RCC_BDCR.

LSIRDY in RCC_BDCR indicates if the LSI oscillator is stable or not. At startup, the clock is not released until this bit is set by hardware. An interrupt can be generated if enabled in RCC_CIER.

11.4.9 System clock (SYSCLK) selection

Four different clock sources can be used to drive the system clock (SYSCLK):

The system clock maximum frequency is 160 MHz. After a system reset, the MSIS oscillator, at 4 MHz, is selected as system clock. When a clock source is used directly or through the PLL as a system clock, it is not possible to stop it.

A switch from one clock source to another occurs only if the target clock source is ready (clock stable after startup delay or PLL locked). If a clock source that is not yet ready is selected, the switch occurs when the clock source becomes ready. Status bits in RCC_CR indicate which clocks are ready and which clock is currently used as a system clock.

The table below gives the different bus frequencies depending on the product voltage range.

Table 114. Bus maximum frequency

Product voltage rangeAHB1/AHB2/AHB3/APB1/APB2/APB3
Range 1160 MHz
Range 2110 MHz
Range 355 MHz
Range 425 MHz

11.4.10 Clock source frequency versus voltage scaling

The table below gives the different clock source frequencies depending on the product voltage range.

Table 115. Clock source maximum frequency

Voltage rangeClock frequency
MSIS, MSIKHSI16HSI48SHS1HSEPLL outputs (VCO min to max)
Range 1All rangesAllowedAllowedAllowed50 MHz208 MHz (1) (128 to 544 MHz)
Range 2All rangesAllowedAllowedAllowed50 MHz110 MHz (128 to 544 MHz)
Range 3All rangesAllowedAllowedAllowed50 MHz55 MHz (128 to 330 MHz)
Range 4Up to 24 MHz rangeAllowedAllowed (divided by 2)Allowed (divided by 2)25 MHzNot allowed
  1. 1. The maximum frequency depends on peripherals connected to PLL outputs.

11.4.11 Clock security system (CSS)

The CSS can be activated by software. In this case, the clock detector is enabled after the HSE oscillator wake-up time, and disabled when this oscillator is stopped.

If a failure is detected on the HSE clock, the HSE oscillator is automatically disabled. A clock failure event is sent to some timers break input and an interrupt is generated to inform the software about the failure (clock security system interrupt CSSI). This allows the MCU to perform rescue operations. The CSSI is linked to the Cortex-M33 NMI (nonmaskable interrupt) exception vector.

Note: Once the CSS is enabled and if the HSE clock fails, the CSSI occurs and an NMI is automatically generated. The NMI is executed indefinitely unless CSSI bit is cleared. As a consequence, in the NMI ISR, the user must clear the CSSI by setting CSSC in RCC_CICR.

If the HSE oscillator is used directly or indirectly as the system clock (indirectly means: it is used as PLL input clock and the PLL clock is used as system clock), a detected failure causes a switch of the system clock to the MSIS or the HSI16 oscillator depending on STOPWUCK configuration in RCC_CR, and the disabling of the HSE oscillator. If the HSE clock (divided or not) is the clock entry of the PLL used as system clock when the failure occurs, the PLL is disabled too.

11.4.12 Clock security system on LSE

A clock security system on LSE can be activated by software writing LSECSSON in RCC_BDCR. This bit can be disabled only by a hardware reset or RTC software reset, or after a failure detection on LSE. LSECSSON must be written after LSE is enabled (LSEON enabled) and ready (LSERDY set by hardware), and after the RTC clock has been selected by RTCSEL.

The CSS on LSE works in all modes, including V BAT mode. It works also under system reset (excluding power-on reset).

The CSS on LSE detects when the LSE disappears or in case of over frequency. In addition, the glitches on LSE can be filtered by setting LSEGFON. LSEGFON must be written when the LSE is disabled (LSEON = 0 and LSERDY = 0).

If a failure is detected on the external 32 kHz oscillator, the LSE clock is no longer supplied to the RTC, but no hardware action is made to the registers. If the MSI was in PLL-mode, this mode is disabled.

The CSS on LSE detection event is connected to the internal tamper 3 of the TAMP:

In case of CSS on LSE detection event (LSECSSD = 1 in RCC_BDCR), the software must then disable the LSECSSON bit, stop the defective 32 kHz oscillator (disabling LSEON), and change the RTC clock source (no clock or LSI or HSE, with RTCSEL), or take any required action to secure the application.

Refer to datasheet for CSS on LSE electrical characteristics.

11.4.13 ADC and DAC clocks

The ADC and DAC kernel clock source is selected thanks to ADCDACSEL[2:0] in RCC_CCIPR3. The ADC clock ratio must be around 50 %. For this reason, the AHB clock, when selected as ADC clock, must not be divided with HPRE prescaler. If pll2_r_ck is selected as ADC clock, the PLL2R division factor must be even (division by 2 or 4 for example).

If the application requires that the ADC or DAC is precisely triggered by a TIMx timer without any uncertainty, the HCLK must be selected as ADC and DAC kernel clock source.

The other clock sources are asynchronous to TIMx timers therefore an uncertainty of the trigger instant is added by the resynchronization between the two clock domains. LPTIMx timers are also asynchronous.

The DAC requires an additional low-power clock (LSI or LSE) to operate in sample and hold mode, available in Stop mode. This clock is selected with DAC1SEL in the RCC_CCIPR3.

11.4.14 RTC and TAMP clock

The RTCCLK clock source is used by RTC and TAMP, and can be either the HSE / 32, LSE, or LSI clock. It is selected by programming RTCSEL[1:0] in RCC_BDCR. This selection cannot be modified without resetting the backup domain. The system must always be configured so as to get a PCLK frequency greater than or equal to the RTCCLK frequency for a proper operation of the RTC. The TAMP does not require any kernel clock if only backup registers are used, with tamper in edge detection mode. All other tamper detection modes require a kernel clock (refer to Section 64: Tamper and backup registers (TAMP) for more details).

LSE and LSI clocks are in the backup domain, whereas the HSE clock is not. Consequently:

When the RTC and TAMP clock is LSE or LSI, the RTC remains clocked and functional under system reset.

If the LSE is needed only for the RTC or TAMP, LSESYSEN must be kept at reset value to get the lowest consumption.

11.4.15 Timer clock

The timer clock frequencies are automatically defined by hardware.

There are two cases:

11.4.16 Watchdog clock

If the independent watchdog (IWDG) is started by either hardware option or software access, the LSI oscillator is forced on and cannot be disabled. After the LSI oscillator temporization, the LSI 32 kHz clock is provided to the IWDG.

11.4.17 OCTOSPI clock

The OCTOSPIx kernel clock, selected by OCTOSPIxSEL[1:0], can be up to 200 MHz when pll1_q_ck or pll2_q_ck are used.

11.4.18 HSPI1 clock

The HSPI1 kernel clock, selected by HSPI1SEL[1:0], can be up to 200 MHz when pll1_q_ck, pll2_q_ck or pll3_r_ck are used.

11.4.19 OTG_HS clock

The OTG_HS kernel clock is generated by the OTG_HS PHY. This PHY can accept only frequencies of following list (16, 19.2, 20, 24, 26 or 32 MHz), with an accuracy of \( \pm 400 \) ppm. Those frequencies can be achieved using either HSE, HSE/2, PLL1_P or PLL1_P/2, and selected by the OTGHSSSEL[1:0] multiplexer. Refer to the OTGHSSSEL description concerning some limitations that apply when using the PLL as its input.

11.4.20 DSI clock

The DSI interface clock can be derived from the internal DSI PHY PLL or by the pll3_p_ck clocks, selected by DSISEL multiplexer.

11.4.21 LTDC clock

The LTDC interface clock can be derived from the pll2_r_ck or pll3_r_ck clocks, selected by LTDCSEL multiplexer.

11.4.22 Clock-out capability

The microcontroller clock output (MCO) capability allows the clock to be output onto the external MCO pin. One of the following clock signals can be selected as MCO clock.

This output remains available in Stop0, Stop1 and Stop2. In Stop modes, selection of available clock signals may be limited.

The selection is controlled by MCOSEL[3:0] in RCC_CR. The selected clock can be divided with MCOPRE[2:0] in RCC_CR.

Another output (LSCO) allows one of the low-speed clocks below to be output onto the external LSCO pin:

This output remains available in all Stop modes, Standby, and Shutdown modes.

This output is not available in \( V_{BAT} \) mode. The selection is controlled by LSCOSEL bit and enabled with LSCOEN in RCC_BDCR.

The MCO clock output requires the corresponding alternate function selected on MCO pin.

11.4.23 Internal/external clock measurement with TIM15/TIM16/TIM17/LPTIM1/LPTIM2

The frequency of all on-board clock sources can be indirectly measured by means of the TIM15, TIM16, or TIM17 channel 1 input capture, and LPTIM1 or LPTIM2 channel 2 input capture.

HSI16 and MSI calibration using LSE

The primary purpose of connecting the LSE to the channel 1 input capture of TIM15, TIM16, and TIM17, and to the channel 2 input capture of LPTIM1, is to be able to precisely measure the HSI16 and MSI system clocks (for this, either HSI16 or MSIS must be used as system clock source). The number of HSI16 (MSIS respectively) clock counts between consecutive edges of the LSE signal provides a measure of the internal clock period. Taking advantage of the high precision of LSE crystals (typically a few tens of ppms), the internal clock frequency can be determined with the same resolution, and the source can be trimmed to compensate the manufacturing, process, temperature and/or voltage related frequency deviations.

The four oscillators of MSI and HSI16 oscillator have dedicated user-accessible calibration bits for this purpose.

The basic concept consists in providing a relative measurement (such as HSI16/LSE ratio). The precision is therefore closely related to the ratio between the two clock sources. The higher the ratio is, the better the measurement is.

Note: When the LSE is available, the MSI can be automatically trimmed by LSE using PLL-mode.

HSI16 and MSI calibration using HSE

If the HSE is available, it can be used as system clock, and the timer input capture must be connected either to MSI (divided by 1024 or by 4) or to HSI/256. TIM16 and TIM17 channel 1 input capture, as well and the LPTIM2 input capture 2, are connected to the divided oscillator only when TIMICSEL[2:0] \( \neq \) 0 in RCC_CCIPR1.

Considering that the timer counter is 16-bit, and that the ratio between HSE and the input capture signal must be the highest possible, a division by 1024 must be selected when MSIRC0, MSIRC1, or MSIRC2 is measured, and a division by 4 when MSIRC4 is measured.

LSI calibration

The calibration of the LSI follows the same principle, but changing the reference clock. The LSI clock must be connected to the channel 1 input capture of the TIM16 or TIM17, or to the channel 2 input capture of the LPTIM1. Then defining the HSE as system clock source, the number of its clock counts between consecutive edges of the LSI signal, provides a measure of the internal low-speed clock period.

The basic concept consists in providing a relative measurement (such as HSE/LSI ratio). The precision is therefore closely related to the ratio between the two clock sources. The higher the ratio is, the better the measurement is.

11.4.24 Peripherals clock gating and autonomous mode

Peripherals clock gating in Run mode

Each peripheral clock can be enabled by the corresponding EN bit in RCC_AHBxENR and RCC_APBxENR registers.

When the peripheral clock is not active, read or write accesses to the peripheral registers are not supported.

The enable bit has a synchronization mechanism to create a glitch-free clock for the peripheral. After the enable bit is set, there the clock is active after 2 cycles of the peripheral bus clock.

Caution: Just after enabling the clock for a peripheral, the software must wait for these two clock cycles before accessing the peripheral registers.

Peripherals clock gating in Sleep and Stop modes

When a peripheral is enabled, its clock can be automatically gated off when the device is in Sleep mode, by clearing the peripheral SMEN bit in RCC_AHBxSMENR and RCC_APBxSMENR. Both EN and SMEN of the peripheral must be set to keep the clock on in Sleep mode.

The SMEN bit of the peripheral is also used to allow peripheral clocking in Stop 0 and Stop 1 modes, upon peripheral request.

When the clock is requested by a peripheral, this clock is distributed to all enabled peripherals. Therefore, the SMEN bit must be cleared before entering Stop mode, if the peripheral is not used in Stop mode.

Caution: The SMEN bit of the peripheral must be set to allow the generation of an interrupt capable to wake up the device from Stop mode. This is not necessary when the peripheral wake-up interrupt is generated through the EXTI.

Peripherals clock gating and autonomous mode in Stop 0/1/2 modes

Some peripherals support autonomous mode (refer to Table 116 ). These peripherals are able to generate a kernel clock request and a AHB/APB bus clock request when they need, in order to operate and update their status register even in Stop mode. Depending on the peripheral configuration, either a DMA request or an interrupt can be associated to the peripheral event.

Upon an AHB or APB bus clock request from an autonomous peripheral, either MSI or HSI16 oscillator is woken up, depending on the oscillator selected by STOPWUCK in RCC_CFGR1.

If the autonomous peripheral is configured with DMA requests enabled, a data transfer is performed thanks to the AHB/APB clock. The bus clocks as well as the oscillator (HSI16 or MSI) are automatically switched off as soon as the transfer is finished, if no other peripheral requests it. The device automatically goes back in Stop mode.

If the autonomous peripheral is configured with interrupt enabled, the interrupt wakes up the device into Run mode.

The autonomous peripherals mapped on AHB3 or APB3 belong to the SmartRun domain and are autonomous in Stop 0, Stop 1, and Stop 2 with the LPDMA1 and SRAM4.

The autonomous peripherals mapped on AHB1, AHB2, APB1, and APB2, belong to the CPU domain, and are autonomous in Stop 0 and Stop 1 mode, only with GPDMA1 and SRAM1/2/3/4/5/6.

The table below shows the list of peripherals with autonomous mode capability.

Table 116. Autonomous peripherals

DomainPeripheralAutonomous in Stop 0, 1 modesAutonomous in Stop 2 modeAssociated DMAAssociated SRAM
CPU domain (CD)U(S)ARTx (x = 1 to 6)Yes (1)NoGPDMA1SRAM1
SRAM2
SRAM3
SRAM4 (2)
SRAM5
SRAM6
SPIx (x = 1,2)
I2Cx (x = 1,2,4,5,6)
LPTIM2
MDF1
GPDMA1-
SmartRun domain (SRD)LPUART1Yes (3)Yes (3)LPDMA1SRAM4
SPI3
I2C3
LPTIMx (x = 1,3,4)
ADF1
DAC1
ADC4
LPDMA1-

1. Enabled if both xxEN and xxSMEN bits of the peripheral are set (xx = instance name)

2. SRAM4 belongs to SmartRun domain (SRD) but can be addressed by GPDMA 1 in Stop 0 and Stop 1 modes.

3. Enabled if all xxEN, xxSMEN, and xxAMEN bits of the peripheral are set (xx = instance name)

For peripherals in the CPU domain, the autonomous mode is enabled in Stop 0 and Stop 1 modes if both xxEN and xxSMEN bits of the peripheral are set.

For peripherals in SmartRun domain, the autonomous mode is enabled in Stop 0, Stop 1, and Stop 2 modes if both xxEN and xxSMEN bits of the peripheral are set, plus xxAMEN bit of the peripheral in RCC_SRDRAMR.

If an autonomous peripheral requests its kernel clock in Stop 0, Stop 1, or Stop 2 mode, the internal oscillator (HSI16 or MSI) is woken up if it was off, and the kernel clock is propagated only to the peripheral requesting it. When the peripheral releases its kernel clock request, the HSI16 or MSI is switched off if no other peripheral requests it.

If an autonomous peripheral belonging to CPU domain requests its bus clock (AHB1, AHB2, APB1, or APB2 clock) in Stop 0 or Stop 1 mode, the internal oscillator (HSI16 or MSI depending on STOPWUCK value in RCC_CFGR1) is woken up if it was off, and the system clock is propagated to all peripherals configured with both xxEN = xxSMEN = 1.

If an autonomous peripheral belonging to SmartRun domain requests its bus clock (AHB3 or APB3 clock) in Stop 0, Stop 1, or Stop 2 mode, the internal oscillator (HSI16 or MSI depending on STOPWUCK value in RCC_CFGR1) is woken up if it was off, and

HCLK3/PCLK3 clocks are propagated to all peripherals of the SmartRun domain configured with xxEN = xxSMEN = xxAMEN = 1.

Caution: The AMEN bit of the peripheral must be set to allow the generation of an interrupt capable to wake up the device from Stop mode. This is not necessary when the peripheral wake-up interrupt is generated through the EXTI.

Note: MSI or HSI16 can be forced to remain on in Stop 0, Stop 1, or Stop 2 mode, by configuring MSIKERON or HSIKERON in RCC_CR. In this case, the oscillator is propagated only to the kernel clock of the enabled autonomous peripherals with this oscillator selected as kernel clock. This allows the peripheral baudrate or conversion rate increase, as there is no need to wait for the oscillator wake-up time when the peripheral requests its kernel clock.

The LSE or LSI selected as peripheral kernel clock remains always on in Stop modes.

AHB3 and APB3 clocks can be forced to remain on by setting SRDRUN in PWR_CR2. This allows the LPDMA1 latency to be improved as there is no need to wait for the oscillator wake-up time when the peripheral requests its bus clock.

11.5 RCC security and privilege functional description

11.5.1 RCC TrustZone security protection modes

When the TrustZone security is activated by TZEN option bit in FLASH_OPTR, the RCC is able to secure RCC configuration and status bits from being modified by nonsecure accesses.

This is configured through RCC_SECCFGR to prevent nonsecure access to read or modify the following features:

If SPRIV = 1 in RCC_PRIVCFGR, the RCC_SECCFGR register can be written only by secure and privileged access. If SPRIV = 0 in RCC_PRIVCFGR, RCC_SECCFGR can be written only by secure access, privileged or unprivileged.

RCC_SECCFGR can be read by secure, nonsecure, privileged and unprivileged access.

When a peripheral is configured as secure, its related clock, reset, clock source selection and clock enable during low-power modes control bits, are also secure in RCC_AHBxENR, RCC_APBxENR, RCC_AHBxSMEN, RCC_APBxSMEN, RCC_SRDAMEN, RCC_CCIPR1, RCC_CCIPR2, RCC_CCIPR3, and RCC_BDCR registers.

The SHSI configuration and status bits are secured when the SAES is configured as secure.

BDRST in RCC_BDCR is secure when at least one function is secure in RTC or TAMP.

A peripheral is secure when:

Table 117 summarizes the RCC secured bits following the security configuration bit in RCC_SECCFGR register.

When one security configuration bit is set, some configuration and status bits are secured. The RCC registers may contain secure and nonsecure bits:

When the TrustZone security is disabled (TZEN = 0 in FLASH_OPTR), all registers are nonsecure. RCC_SECCFGR write accesses are ignored.

Table 117. RCC security configuration summary

Configuration bit in RCC_SECCFGRSecured bitsCorresponding register
HSISECHSION, HSIKERON, HSIRDYRCC_CR
HSICAL[7:0], HSITRIM[6:0]RCC_ICSCR3
HSIRDYIERCC_CIER
HSIRDYIFRCC_CIFR
HSIRDYCRCC_CICR
HSESECHSEON, HSERDY, HSEBYP, CSSON, HSEEXTRCC_CR
HSERDYIERCC_CIER
HSERDYIF, CSSFRCC_CIFR
HSERDYC, CSSCRCC_CICR
MSISECMSISON, MSIKERON, MSISRDY, MSIPLLEN, MSIKON, MSIKRDY, MSIPLLSEL, MSIPLLFASTRCC_CR
MISIRANGE[3:0], MISIKRANGE[3:0], MSIRGSEL, MSIBIAS, MSICAL0[4:0], MSICAL1[4:0], MSICAL2[4:0], MSICAL3[4:0]RCC_ICSCR1
MSITRIM0[4:0], MSITRIM1[4:0], MSITRIM2[4:0], MSITRIM3[4:0]RCC_ICSCR2
MSISRDYIE, MSIKRDYIERCC_CIER
MSISRDYIF, MSIKRDYIFRCC_CIFR
MSISRDYIC, MSIKRDYICRCC_CICR
MSISSRANGE[3:0], MSIKSRANGE[3:0]RCC_CSR

Table 117. RCC security configuration summary (continued)

Configuration bit in
RCC_SECCFGR
Secured bitsCorresponding
register
LSISECLSION, LSIRDY, LSIPREDIV, LSCOSEL, LSCOENRCC_BDCR
LSIRDYIERCC_CIER
LSIRDYIFRCC_CIFR
LSIRDYCRCC_CICR
LSESECLSECSSON, LSECSSD, LSEDRV[1:0], LSEBYP, LSERDY, LSEON, LSEGON, LSESYSRDY, LSESYSEN, LSCOSEL, LSCOENRCC_BDCR
LSERDYIERCC_CIER
LSERDYFRCC_CIFR
LSERDYCRCC_CICR
SYSCLKSECSW[1:0], SWS[1:0], STOPWUCK, STOPKERWUCK, MCOSEL[3:0], MCOPRE[2:0]RCC_CFGR1
SYSTICKSEL[1:0]RCC_CCIPR1
VOS[1:0]PWR_VOSR
PRESCSECHPRE[3:0], PPRE1[2:0], PPRE2[2:0]RCC_CFGR2
PPRE3[2:0]RCC_CFGR3
PLL1SECPLL1SRC[1:0], PLL1RGE[1:0], PLL1FRACEN, PLL1M[3:0], PLL1MBOOST[3:0], PLL1PEN, PLL1QEN, PLL1RENRCC_PLL1CFGR
PLL1N[8:0], PLL1P[6:0], PLL1Q[6:0], PLL1R[6:0]RCC_PLL1DIVR
PLL1FRACN[12:0]RCC_PLL1FRACR
PLL1RDY, PLL1ONRCC_CR
PLL1RDYIERCC_CIER
PLL1RDYFRCC_CIFR
PLL1RDYCRCC_CICR
PLL2SECPLL2SRC[1:0], PLL2RGE[1:0], PLL2FRACEN, PLL2M[3:0], PLL2PEN, PLL2QEN, PLL2RENRCC_PLL2CFGR
PLL2N[8:0], PLL2P[6:0], PLL2Q[6:0], PLL2R[6:0]RCC_PLL2DIVR
PLL2FRACN[12:0]RCC_PLL2FRACR
PLL2RDY, PLL2ONRCC_CR
PLL2RDYIERCC_CIER
PLL2RDYFRCC_CIFR
PLL2RDYCRCC_CICR

Table 117. RCC security configuration summary (continued)

Configuration bit in RCC_SECCFGRSecured bitsCorresponding register
PLL3SECPLL3SRC[1:0], PLL3RGE[1:0], PLL3FRACEN, PLL3M[3:0], PLL3PEN, PLL3QEN, PLL3RENRCC_PLL3CFGR
PLL3N[8:0], PLL3P[6:0], PLL3Q[6:0], PLL3R[6:0]RCC_PLL3DIVR
PLL3FRACN[12:0]RCC_PLL3FRACR
PLL3RDY, PLL3ONRCC_CR
PLL3RDYIERCC_CIER
PLL3RDYFRCC_CIFR
PLL3RDYCRCC_CICR
HSI48SEC (1)HSI48ON, HSI48RDYRCC_CR
HSI48CAL[8:0]RCC_CRRCR
HSI48RDYERCC_CIER
HSI48RDYFRCC_CIFR
HSI48RDYCRCC_CICR
ICLKSELICLKSEL[1:0]RCC_CCIPR1
RMVFSECRMVFRCC_CSR

1. TRIM field of the HSI48 is located in CRS peripheral. Be sure to secure it using CRSSEC bit in GTZC1 TZSC secure configuration register 1.

11.5.2 RCC privilege protection modes

By default, after reset, all RCC registers can be read or written with both privileged and unprivileged access, except RCC_PRIVCFGR that can be written with privileged access only. RCC_PRIVCFGR can be read by secure and nonsecure, privileged and unprivileged access.

SPRIV in RCC_PRIVCFGR can be written with secure privileged access only. This bit configures the privileged access of all RCC secure functions (as defined by RCC_SECCFGR), or by the GTZC for securable peripherals, or by the peripheral itself in case of TrustZone-aware peripherals).

When SPRIV = 1 in RCC_PRIVCFGR:

NSPRIV in RCC_PRIVCFGR can be written with privileged access only, secure or nonsecure functions (as defined by RCC_SECCFGR, or by the GTZC for securable peripherals, or by the peripheral itself in case of TrustZone-aware peripherals).

When NSPRIV = 1 in RCC_PRIVCFGGR:

11.6 RCC low-power modes

The CPU deep-sleep mode can be overridden for debugging by setting the DBG_STOP or DBG_STANDBY bit in the DBGMCU_CR register.

When exiting Stop modes (Stop 0, Stop 1, Stop 2, or Stop 3), the system clock is either MSIS or HSI16, depending on STOPWUCK in RCC_CFGR1. The frequency (range and user trim) of MSIS and MSIK oscillators is the one configured before entering Stop mode, except if above 24 MHz. In this case, the MSIS or MSIK range is the 24 MHz range. The user trim of HSI16 is kept. If MSI is in PLL-mode before entering Stop mode with MSIPLLFAST = 0, the PLL-mode stabilization time must be waited for after wake-up even if the LSE was kept on during Stop mode. The PLL-mode accuracy is kept after wake-up from Stop 0, Stop 1, or Stop 2 mode without stabilization time if MSIPLLFAST = 1. MSIPLLFAST bit has no effect when exiting Stop 3 mode.

The other internal oscillator can be automatically woken up in addition to the one used by the system clock, in order to avoid waiting for the other oscillator wake-up time when the device is back in Run mode. This is done thanks to STOPKERWUCK in RCC_CFGR1.

When leaving the Standby and Shutdown modes, the system clock is MSIS. The MSIS and MSIK frequency at wake-up from Standby mode is configured with MSISSRANGE and MSIKSRANGE in RCC_CSR, from 1 to 4 MHz. The MSI frequency at wake-up from Shutdown mode is 4 MHz. The user trim is lost.

If a flash memory programming operation is ongoing, a Stop, Standby, or Shutdown mode entry is delayed until the flash memory interface access is finished. If an access to the APB domain is ongoing, a Stop, Standby, or Shutdown mode entry is delayed until the APB access is finished. If an autonomous peripheral generates a system clock request, a Stop, Standby, or Shutdown mode entry is delayed until the system clock request is released.

11.7 RCC interrupts

The table below summarizes the interrupt sources and the way to control them.

Table 118. Interrupt sources and control

Interrupt vectorInterrupt event flagDescriptionEnable control bitInterrupt clear methodExit Sleep modeExit Stop, Standby, Shutdown modes
RCCLSIRDYFLSI readyLSIRDYIE and LSISEC = 0Set LSIRDYC to 1YesNo
LSERDYFLSE readyLSERDYIE and LSESEC = 0Set LSERDYC to 1YesNo
HSIDRYFHSI readyHSIDRYIE and HSISEC = 0Set HSIRDYC to 1YesNo
HSERDYFHSE readyHSERDYIE and HSESEC = 0Set HSERDYC to 1YesNo
MSISRDYFMSIS readyMSISRDYIE and MSISEC = 0Set MSISRDYC to 1YesNo
MSIKRDYFMSIK readyMSIKRDYIE and MSISEC = 0Set MSIKRDYC to 1YesNo
SHSIRDYFSHSI readySHSIRDYIE and SAESSEC = 0 (in GTZC)Set SHSIRDYC to 1YesNo
HSI48RDYFHSI48 readyHSI48RDYIE and HSI48SEC = 0Set HSI48RDYC to 1YesNo
PLL1RDYFPLL1 readyPLL1RDYIE and PLL1SEC = 0Set PLL1RDYC to 1YesNo
PLL2RDYFPLL2 readyPLL2RDYIE and PLL2SEC = 0Set PLL2RDYC to 1YesNo
PLL3RDYFPLL3 readyPLL3RDYIE and PLL3SEC = 0Set PLL3DYC to 1YesNo
RCC_S (1)LSIRDYFLSI readyLSIRDYIE and LSISEC = 1Set LSIRDYC to 1YesNo
LSERDYFLSE readyLSERDYIE and LSESEC = 1Set LSERDYC to 1YesNo
HSIDRYFHSI readyHSIDRYIE and HSISEC = 1Set HSIRDYC to 1YesNo
HSERDYFHSE readyHSERDYIE and HSESEC = 1Set HSERDYC to 1YesNo
MSISRDYFMSIS readyMSISRDYIE and MSISEC = 1Set MSISRDYC to 1YesNo
MSIKRDYFMSIK readyMSIKRDYIE and MSISEC = 1Set MSIKRDYC to 1YesNo

Table 118. Interrupt sources and control (continued)

Interrupt vectorInterrupt event flagDescriptionEnable control bitInterrupt clear methodExit Sleep modeExit Stop, Standby, Shutdown modes
RCC_S (1)SHSIRDYFSHSI readySHSIRDYIE and SAESSEC (2) = 1Set SHSIRDYC to 1YesNo
HSI48RDYFHSI48 readyHSI48RDYIE and HSI48SEC = 1Set HSI48RDYC to 1YesNo
PLL1RDYFPLL1 readyPLL1RDYIE and PLL1SEC = 1Set PLL1RDYC to 1YesNo
PLL2RDYFPLL2 readyPLL2RDYIE and PLL2SEC = 1Set PLL2RDYC to 1YesNo
PLL3RDYFPLL3 readyPLL3RDYIE and PLL3SEC = 1Set PLL3RDYC to 1YesNo
TAMPITAMP3F (3)LSE CSS failureLSECSSON and ITAMP3E (3) and ITAMP3IE (3)Set CITAMP3F (3) to 1YesYes
NMICSSFHSE CSS failure_(4)Set CSSC to 1YesNo
LSECSS (5)Through EXTILSE CSS failureThrough EXTIThrough EXTIYesYes (6) /No
MSI_PLL_UNLOCK (5)Through EXTIMSI PLL-mode unlock (7)Through EXTIThrough EXTIYesYes (6) /No

1. The RCC secure interrupt vector is used only when TrustZone is enabled.

2. The SAESSEC bit is in the GTZC peripheral.

3. The LSE CSS failure event (LSECSSD) is connected to TAMP internal tamper 3. In order to get the interrupt associated to this event, the internal tamper 3 must be enabled, and the internal tamper 3 interrupt must be enabled. The ITAMP3F, ITAMP3E, ITAMP3IE, and CITAMP3F bits are in the TAMP peripheral. Consequently, the LSE CSS tamper interrupt erases or blocks the device secrets as described in Table 644: TAMP interconnection .

4. It is not possible to mask this interrupt when the security system feature is enabled (CSSON = 1).

5. Not available in STM32U575/585 rev. X devices. Available in all other STM32U575/585 revisions, and in the other STM32U5 Series devices.

6. This interrupt can wake up from Stop 0, Stop 1, and Stop 2 modes only.

7. This interrupt indicates that the MSI has left the PLL_mode, due to LSE missing pulses. As a consequence, the MSI frequency accuracy is degraded.

11.8 RCC registers

11.8.1 RCC clock control register (RCC_CR)

Address offset: 0x000

Reset value: 0x0000 0035

Access: no wait state; word, half-word, and byte access

HSEBYP and HSEEXT are cleared upon power-on reset. They are not affected upon other types of reset.

31302928272625242322212019181716
Res.Res.PLL3R
DY
PLL3O
N
PLL2R
DY
PLL2O
N
PLL1R
DY
PLL1O
N
Res.Res.Res.HSEEXTCSSO
N
HSEBY
P
HSE
RD
Y
HSE
O
N
rrwrrwrrwrwrsrwrrw
1514131211109876543210
SHSIR
DY
SHSIO
N
HSI48R
DY
HSI48
ON
Res.HSIRD
Y
HSIKE
RON
HSIONMSIPL
LFAST
MSIPL
LSEL
MSIKR
DY
MSIKO
N
MSIPL
LEN
MSISR
DY
MSIKE
RON
MSISO
N
rrwrrwrrwrwrwrwrrwrwrrwrw

Bits 31:30 Reserved, must be kept at reset value.

Bit 29 PLL3RDY : PLL3 clock ready flag

This bit is set by hardware to indicate that the PLL3 is locked.

0: PLL3 unlocked

1: PLL3 locked

Bit 28 PLL3ON : PLL3 enable

This bit is set and cleared by software to enable PLL3. It is cleared by hardware when entering Stop, Standby, or Shutdown mode.

0: PLL3 OFF

1: PLL3 ON

Bit 27 PLL2RDY : PLL2 clock ready flag

This bit is set by hardware to indicate that the PLL2 is locked.

0: PLL2 unlocked

1: PLL2 locked

Bit 26 PLL2ON : PLL2 enable

This bit is set and cleared by software to enable PLL2. It is cleared by hardware when entering Stop, Standby, or Shutdown mode.

0: PLL2 OFF

1: PLL2 ON

Bit 25 PLL1RDY : PLL1 clock ready flag

This bit is set by hardware to indicate that the PLL1 is locked.

0: PLL1 unlocked

1: PLL1 locked

Bit 24 PLL1ON: PLL1 enable

This bit is set and cleared by software to enable the main PLL. It is cleared by hardware when entering Stop, Standby, or Shutdown mode. This bit cannot be reset if the PLL1 clock is used as the system clock.

0: PLL1 OFF

1: PLL1 ON

Bits 23:21 Reserved, must be kept at reset value.

Bit 20 HSEEXT: HSE external clock bypass mode

This bit is set and reset by software to select the external clock mode in bypass mode.

External clock mode must be configured with HSEON bit to be used by the device. This bit can be written only if the HSE oscillator is disabled. This bit is active only if the HSE bypass mode is enabled.

0: external HSE clock analog mode

1: external HSE clock digital mode (through I/O Schmitt trigger)

Bit 19 CSSON: Clock security system enable

This bit is set by software to enable the clock security system. When CSSON is set, the clock detector is enabled by hardware when the HSE oscillator is ready, and disabled by hardware if a HSE clock failure is detected. This bit is set only and is cleared by reset.

0: clock security system OFF (clock detector OFF)

1: clock security system ON (clock detector ON if the HSE oscillator is stable, OFF if not).

Bit 18 HSEBYP: HSE crystal oscillator bypass

This bit is set and cleared by software to bypass the oscillator with an external clock.

The external clock must be enabled with the HSEON bit set, to be used by the device.

This bit can be written only if the HSE oscillator is disabled.

0: HSE crystal oscillator not bypassed

1: HSE crystal oscillator bypassed with external clock

Bit 17 HSERDY: HSE clock ready flag

This bit is set by hardware to indicate that the HSE oscillator is stable.

0: HSE oscillator not ready

1: HSE oscillator ready

Note: Once the HSEON bit is cleared, HSERDY goes low after six HSE clock cycles.

Bit 16 HSEON: HSE clock enable

This bit is set and cleared by software. It is cleared by hardware to stop the HSE oscillator when entering Stop, Standby, or Shutdown mode. This bit cannot be reset if the HSE oscillator is used directly or indirectly as the system clock.

0: HSE oscillator off

1: HSE oscillator on

Bit 15 SHSIRDY: SHSI clock ready flag

This bit is set by hardware to indicate that the SHSI oscillator is stable. It is set only when SHSI is enabled by software (by setting SHSION).

0: SHSI oscillator not ready

1: SHSI oscillator ready

Note: Once the SHSION bit is cleared, SHSIRDY goes low after six SHSI clock cycles.

Bit 14 SHSION: SHSI clock enable

This bit is set and cleared by software. It is cleared by hardware to stop the SHSI when entering in Stop, Standby, or Shutdown modes.

0: SHSI oscillator off

1: SHSI oscillator on

Bit 13 HSI48RDY: HSI48 clock ready flag

This bit is set by hardware to indicate that HSI48 oscillator is stable. It is set only when HSI48 is enabled by software (by setting HSI48ON).

0: HSI48 oscillator not ready

1: HSI48 oscillator ready

Bit 12 HSI48ON: HSI48 clock enable

This bit is set and cleared by software. It is cleared by hardware to stop the HSI48 when entering in Stop, Standby, or Shutdown modes.

0: HSI48 oscillator off

1: HSI48 oscillator on

Bit 11 Reserved, must be kept at reset value. Bit 10 HSIRDY: HSI16 clock ready flag

This bit is set by hardware to indicate that HSI16 oscillator is stable. It is set only when HSI16 is enabled by software (by setting HSION).

0: HSI16 oscillator not ready

1: HSI16 oscillator ready

Note: Once the HSION bit is cleared, HSIRDY goes low after six HSI16 clock cycles.

Bit 9 HSIKERON: HSI16 enable for some peripheral kernels

This bit is set and cleared by software to force HSI16 ON even in Stop modes. Keeping HSI16 on in Stop mode allows the communication speed not to be reduced by the HSI16 startup time. This bit has no effect on HSION value. Refer to Section 11.4.24 for more details. This bit must be configured at 0 before entering Stop 3 mode.

0: No effect on HSI16 oscillator

1: HSI16 oscillator forced on even in Stop mode

Bit 8 HSION: HSI16 clock enable

This bit is set and cleared by software. It is cleared by hardware to stop the HSI16 oscillator when entering Stop, Standby, or Shutdown mode. This bit is set by hardware to force the HSI16 oscillator on when STOPWUCK = 1 when leaving Stop modes, or in case of failure of the HSE crystal oscillator. This bit is set by hardware if the HSI16 is used directly or indirectly as system clock.

0: HSI16 oscillator off

1: HSI16 oscillator on

Bit 7 MSIPLLFAST: MSI PLL mode fast startup

This bit is set and reset by software to enable/disable the fast PLL mode start-up of the MSI clock source. This bit is used only if PLL mode is selected (MSIPLLEN = 1).

Caution: The fast start-up feature is not active the first time the PLL mode is selected.

The fast start-up is active when the MSI in PLL mode returns from switch off.

0: MSI PLL normal start-up

1: MSI PLL fast start-up

Bit 6 MSIPLLSEL: MSI clock with PLL mode selection

This bit is set and cleared by software to select which MSI output clock uses the PLL mode. It can be written only when the MSI PLL mode is disabled (MSIPLLEN = 0).

0: PLL mode applied to MSIK (MSI kernel) clock output

1: PLL mode applied to MSIS (MSI system) clock output

Note: If the MSI kernel clock output uses the same oscillator source than the MSI system clock output, then the PLL mode is applied to both clock outputs.

Bit 5 MSIKRDY: MSIK clock ready flag

This bit is set by hardware to indicate that the MSIK is stable. It is set only when MSI kernel oscillator is enabled by software by setting MSIKON.

0: MSIK (MSI kernel) oscillator not ready

1: MSIK (MSI kernel) oscillator ready

Note: Once MSIKON bit is cleared, MSIKRDY goes low after six MSIK oscillator clock cycles.

Bit 4 MSIKON: MSIK clock enable

This bit is set and cleared by software. It is cleared by hardware to stop the MSIK when entering Stop, Standby, or Shutdown mode. This bit is set by hardware to force the MSIK oscillator ON when exiting Standby or Shutdown mode. It is set by hardware to force the MSIK oscillator on when STOPWUCK = 0 or STOPKERWUCK = 0 when exiting Stop modes, or in case of a failure of the HSE oscillator.

0: MSIK (MSI kernel) oscillator disabled

1: MSIK (MSI kernel) oscillator enabled

Bit 3 MSIPLLEN: MSI clock PLL-mode enable

This bit is set and cleared by software to enable/disable the PLL part of the MSI clock source. MSIPLLEN must be enabled after LSE is enabled (LSEON enabled) and ready (LSERDY set by hardware). A hardware protection prevents from enabling MSIPLLEN if LSE is not ready. This bit is cleared by hardware when LSE is disabled (LSEON = 0) or when the CSS on LSE detects a LSE failure (see RCC_CSR).

0: MSI PLL-mode OFF

1: MSI PLL-mode ON

Bit 2 MSISRDI: MSIS clock ready flag

This bit is set by hardware to indicate that the MSIS oscillator is stable. It is set only when MSIS is enabled by software (by setting MSISON).

0: MSIS (MSI system) oscillator not ready

1: MSIS (MSI system) oscillator ready

Note: Once the MSISON bit is cleared, MSISRDI goes low after six MSIS clock cycles.

Bit 1 MSIKERON: MSI enable for some peripheral kernels

This bit is set and cleared by software to force MSI ON even in Stop modes. Keeping the MSI on in Stop mode allows the communication speed not to be reduced by the MSI startup time. This bit has no effect on MSISON and MSIKON values (see Section 11.4.24 for more details). This bit must be configured at 0 before entering Stop 3 mode.

0: No effect on MSI oscillator

1: MSI oscillator forced ON even in Stop mode

Bit 0 MSISON: MSIS clock enable

This bit is set and cleared by software. It is cleared by hardware to stop the MSIS oscillator when entering Stop, Standby or Shutdown mode. This bit is set by hardware to force the MSIS oscillator on when exiting Standby or Shutdown mode. It is set by hardware to force the MSIS oscillator ON when STOPWUCK = 0 when exiting Stop modes, or in case of a failure of the HSE oscillator.

Set by hardware when used directly or indirectly as system clock.

0: MSIS (MSI system) oscillator off

1: MSIS (MSI system) oscillator on

11.8.2 RCC internal clock sources calibration register 1 (RCC_ICSCR1)

Address offset: 0x008

Reset value: 0x440X XXXX

X is factory-programmed.

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
MSISRANGE[3:0]MSIKRANGE[3:0]MSIRG
SEL
MSIBIA
S
Res.Res.MSICAL0[4:1]
rwrwrwrwrwrwrwrwrsrwrrrr
1514131211109876543210
MSICAL
L0[0]
MSICAL1[4:0]MSICAL2[4:0]MSICAL3[4:0]
rrrrrrrrrrrrrrrr

Bits 31:28 MSISRANGE[3:0] : MSIS clock ranges

These bits are configured by software to choose the frequency range of MSIS oscillator when MSIRGSEL is set. 16 frequency ranges are available:

Note: MSISRANGE can be modified when MSIS is off (MSISON = 0) or when MSIS is ready (MSISRDY = 1). MSISRANGE must NOT be modified when MSIS is on and NOT ready (MSISON = 1 and MSISRDY = 0)

MSISRANGE is kept when the device wakes up from Stop mode, except when the MSIS range is above 24 MHz. In this case MSISRANGE is changed by hardware into range 2 (24 MHz).

Note: The frequencies slightly differ in PLL-mode. Refer to the datasheet for more information.

Bits 27:24 MSIKRANGE[3:0]: MSIK clock ranges

These bits are configured by software to choose the frequency range of MSIK oscillator when MSIRGSEL is set. 16 frequency ranges are available:

Note: MSIKRANGE can be modified when MSIK is off (MSISON = 0) or when MSIK is ready (MSIKRDY = 1). MSIKRANGE must NOT be modified when MSIK is on and NOT ready (MSIKON = 1 and MSIKRDY = 0)

MSIKRANGE is kept when the device wakes up from Stop mode, except when the MSIK range is above 24 MHz. In this case MSIKRANGE is changed by hardware into range 2 (24 MHz).

Note: The frequencies slightly differ in PLL-mode. Refer to the datasheet for more information.

Bit 23 MSIRGSEL: MSI clock range selection

This bit is set by software to select the MSIS and MSIK clocks range with MSISRANGE[3:0] and MSIKRANGE[3:0]. Write 0 has no effect.

After exiting Standby or Shutdown mode, or after a reset, this bit is at 0 and the MSIS and MSIK ranges are provided by MSISSRANGE[3:0] and MSIKSRANGE[3:0] in RCC_CSR.

0: MSIS/MSIK ranges provided by MSISSRANGE[3:0] and MSIKSRANGE[3:0] in RCC_CSR

1: MSIS/MSIK ranges provided by MSISRANGE[3:0] and MSIKRANGE[3:0] in RCC_ICSCR1

Bit 22 MSIBIAS: MSI bias mode selection

This bit is set by software to select the MSI bias mode. By default, the MSI bias is in continuous mode in order to maintain the output clocks accuracy. Setting this bit reduces the MSI consumption when the regulator is in range 4, or when the device is in Stop 1 or Stop 2 mode, but it decreases the MSI accuracy

0: MSI bias continuous mode (clock accuracy fast settling time)

1: MSI bias sampling mode when the regulator is in range 4, or when the device is in Stop 1 or Stop 2 (ultra-low-power mode)

Bits 21:20 Reserved, must be kept at reset value.

Bits 19:15 MSICAL0[4:0] : MSIRC0 clock calibration for MSI ranges 0 to 3

These bits are initialized at startup with the factory-programmed MSIRC0 calibration trim value for ranges 0 to 3. When MSITRIM0 is written, MSICAL0 is updated with the sum of MSITRIM0[4:0] and the factory-programmed calibration trim value MSIRC0[4:0].

Caution: There is no hardware protection to limit a potential overflow due to the addition of MSITRIM bitfield and factory program bitfield for this calibration value. Control must be managed by software at user level.

Bits 14:10 MSICAL1[4:0] : MSIRC1 clock calibration for MSI ranges 4 to 7

These bits are initialized at startup with the factory-programmed MSIRC1 calibration trim value for ranges 4 to 7. When MSITRIM1 is written, MSICAL1 is updated with the sum of MSITRIM1[4:0] and the factory calibration trim value MSIRC1[4:0].

Caution: There is no hardware protection to limit a potential overflow due to the addition of MSITRIM bitfield and factory program bitfield for this calibration value. Control must be managed by software at user level.

Bits 9:5 MSICAL2[4:0] : MSIRC2 clock calibration for MSI ranges 8 to 11

These bits are initialized at startup with the factory-programmed MSIRC2 calibration trim value for ranges 8 to 11. When MSITRIM2 is written, MSICAL2 is updated with the sum of MSITRIM2[4:0] and the factory calibration trim value MSIRC2[4:0].

Caution: There is no hardware protection to limit a potential overflow due to the addition of MSITRIM bitfield and factory program bitfield for this calibration value. Control must be managed by software at user level.

Bits 4:0 MSICAL3[4:0] : MSIRC3 clock calibration for MSI ranges 12 to 15

These bits are initialized at startup with the factory-programmed MSIRC3 calibration trim value for ranges 12 to 15. When MSITRIM3 is written, MSICAL3 is updated with the sum of MSITRIM3[4:0] and the factory calibration trim value MSIRC3[4:0].

Caution: There is no hardware protection to limit a potential overflow due to the addition of MSITRIM bitfield and factory program bitfield for this calibration value. Control must be managed by software at user level.

11.8.3 RCC internal clock sources calibration register 2 (RCC_ICSCR2)

Address offset: 0x00C

Reset value: 0x0008 4210

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.MSITRIM0[4:1]
rwrwrwrw
1514131211109876543210
MSITRIM0[0]MSITRIM1[4:0]MSITRIM2[4:0]MSITRIM3[4:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:20 Reserved, must be kept at reset value.

Bits 19:15 MSITRIM0[4:0] : MSI clock trimming for ranges 0 to 3

These bits provide an additional user-programmable trimming value that is added to the factory-programmed calibration trim value MSIRC0[4:0] bits. It can be programmed to adjust to voltage and temperature variations that influence the frequency of the MSI.

Bits 14:10 MSITRIM1[4:0] : MSI clock trimming for ranges 4 to 7

These bits provide an additional user-programmable trimming value that is added to the factory-programmed calibration trim value MSIRC1[4:0] bits. It can be programmed to adjust to voltage and temperature variations that influence the frequency of the MSI.

Bits 9:5 MSITRIM2[4:0] : MSI clock trimming for ranges 8 to 11

These bits provide an additional user-programmable trimming value that is added to the factory-programmed calibration trim value MSIRC2[4:0] bits. It can be programmed to adjust to voltage and temperature variations that influence the frequency of the MSI.

Bits 4:0 MSITRIM3[4:0] : MSI clock trimming for ranges 12 to 15

These bits provide an additional user-programmable trimming value that is added to the factory-programmed calibration trim value MSIRC3[4:0] bits. It can be programmed to adjust to voltage and temperature variations that influence the frequency of the MSI.

Note: The hardware auto calibration with LSE must not be used in conjunction with software calibration.

11.8.4 RCC internal clock sources calibration register 3 (RCC_ICSCR3)

Address offset: 0x010

Reset value: 0x0010 0XXX

X is factory-programmed.

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.HSITRIM[4:0]
rwrwrwrwrw
1514131211109876543210
Res.Res.Res.Res.HSICAL[11:0]
rrrrrrrrrrrr

Bits 31:21 Reserved, must be kept at reset value.

Bits 20:16 HSITRIM[4:0] : HSI clock trimming

These bits provide an additional user-programmable trimming value. It can be programmed to adjust to voltage and temperature variations that influence the frequency of the HSI.

Bits 15:12 Reserved, must be kept at reset value.

Bits 11:0 HSICAL[11:0] : HSI clock calibration

These bits are initialized at startup with the factory-programmed HSI calibration trim value.

11.8.5 RCC clock recovery RC register (RCC_CRRCR)

Address offset: 0x014

Reset value: 0x0000 0XXX

X is factory-programmed.

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.Res.Res.Res.Res.HSI48CAL[8:0]
rrrrrrrrr

Bits 31:9 Reserved, must be kept at reset value.

Bits 8:0 HSI48CAL[8:0] : HSI48 clock calibration

These bits are initialized at startup with the factory-programmed HSI48 calibration trim value.

11.8.6 RCC clock configuration register 1 (RCC_CFGR1)

Address offset: 0x01C

Reset value: 0x0000 0000

Access: 0 ≤ wait state ≤ 2; word, half-word, and byte access

1 or 2 wait states are inserted only if the access occurs during clock source switch.

31302928272625242322212019181716
Res.MCOPRE[2:0]MCOSEL[3:0]Res.Res.Res.Res.Res.Res.Res.Res.
rwrwrwrwrwrwrw
1514131211109876543210
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.STOPK
ERWU
CK
STOP
WUCK
SWS[1:0]SW[1:0]
rwrwrrrwrw

Bit 31 Reserved, must be kept at reset value.

Bits 30:28 MCOPRE[2:0] : microcontroller clock output prescaler

This bitfield is set and cleared by software. It is highly recommended to change this prescaler before MCO output is enabled.

Bits 27:24 MCOSEL[3:0] : microcontroller clock output

This bitfield is set and cleared by software.

0000: MCO output disabled, no clock on MCO

0001: SYSCLK system clock selected

0010: MSIS clock selected

0011: HSI16 clock selected

0100: HSE clock selected

0101: Main PLL clock pll1_r_ck selected

0110: LSI clock selected

0111: LSE clock selected

1000: Internal HSI48 clock selected

1001: MSIK clock selected

Others: reserved

Note: This clock output may have some truncated cycles at startup or during MCO clock source switching.

Bits 23:6 Reserved, must be kept at reset value.

Bit 5 STOPKERWUCK : wake-up from Stop kernel clock automatic enable selection

This bit is set and cleared by software to enable automatically another oscillator when exiting Stop mode. This oscillator can be used as independent kernel clock by peripherals.

0: MSIK oscillator automatically enabled when exiting Stop mode or when a CSS on HSE event occurs.

1: HSI16 oscillator automatically enabled when exiting Stop mode or when a CSS on HSE event occurs.

Bit 4 STOPWUCK : wake-up from Stop and CSS backup clock selection

This bit is set and cleared by software to select the system clock used when exiting Stop mode. The selected clock is also used as emergency clock for the clock security system on HSE.

Note: If this bit is used for CSS backup clock selection, the STOPKERWUCK bit value must be programmed with the same value than STOPWUCK to avoid the other oscillator power-on after CSS event.

Caution: STOPWUCK must not be modified when the CSS is enabled by CSSON in RCC_CR, and the system clock is HSE (SWS = 10) or a switch on HSE is requested (SW = 10).

0: MSIS oscillator selected as wake-up from stop clock and CSS backup clock

1: HSI16 oscillator selected as wake-up from stop clock and CSS backup clock

Bits 3:2 SWS[1:0] : system clock switch status

This bitfield is set and cleared by hardware to indicate which clock source is used as system clock.

00: MSIS oscillator used as system clock

01: HSI16 oscillator used as system clock

10: HSE used as system clock

11: PLL pll1_r_ck used as system clock

Bits 1:0 SW[1:0] : system clock switch

This bitfield is set and cleared by software to select system clock source (SYSCLK). It is configured by hardware to force MSIS oscillator selection when exiting Standby or Shutdown mode. This bitfield is configured by hardware to force MSIS or HSI16 oscillator selection when exiting Stop mode or in case of HSE oscillator failure, depending on STOPWUCK.

00: MSIS selected as system clock

01: HSI16 selected as system clock

10: HSE selected as system clock

11: PLL pll1_r_ck selected as system clock

11.8.7 RCC clock configuration register 2 (RCC_CFGR2)

Address offset: 0x020

Reset value: 0x0000 0000 (for STM32U535/545/575/585)

Reset value: 0x0000 6000 (for STM32U59x/5Ax/5Fx/5Gx)

Access: word, half-word, and byte access

From 0 to 15 wait states are inserted if the access occurs when the APB or AHB prescalers values update is on going.

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.APB2D
IS
APB1D
IS
AHB2D
IS2
AHB2D
IS1
AHB1D
IS
rwrwrwrwrw
1514131211109876543210
Res.DPRE[2:0]Res.PPRE2[2:0]Res.PPRE1[2:0]HPRE[3:0]
rwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:21 Reserved, must be kept at reset value.

Bit 20 APB2DIS : APB2 clock disable

This bit can be set in order to further reduce power consumption, when none of the APB2 peripherals are used and when their clocks are disabled in RCC_APB2ENR. When this bit is set, all APB2 peripherals clocks are off.

0: APB2 clock enabled, distributed to peripherals according to their dedicated clock enable control bits

1: APB2 clock disabled

Bit 19 APB1DIS : APB1 clock disable

This bit can be set in order to further reduce power consumption, when none of the APB1 peripherals (except IWDG) are used and when their clocks are disabled in RCC_APB1ENR. When this bit is set, all the APB1 peripherals clocks are off, except for IWDG.

0: APB1 clock enabled, distributed to peripherals according to their dedicated clock enable control bits

1: APB1 clock disabled

Bit 18 AHB2DIS2 : AHB2_2 clock disable

This bit can be set in order to further reduce power consumption, when none of the AHB2 peripherals from RCC_AHB2ENR2 are used and when their clocks are disabled in RCC_AHB2ENR2. When this bit is set, all the AHB2 peripherals clocks from RCC_AHB2ENR2 are off.

0: AHB2_2 clock enabled, distributed to peripherals according to their dedicated clock enable control bits

1: AHB2_2 clock disabled

Bit 17 AHB2DIS1 : AHB2_1 clock disable

This bit can be set in order to further reduce power consumption, when none of the AHB2 peripherals from RCC_AHB2ENR1 (except SRAM2 and SRAM3) are used and when their clocks are disabled in RCC_AHB2ENR1. When this bit is set, all the AHB2 peripherals clocks from RCC_AHB2ENR1 are off, except for SRAM2 and SRAM3.

0: AHB2_1 clock enabled, distributed to peripherals according to their dedicated clock enable control bits

1: AHB2_1 clock disabled

Bit 16 AHB1DIS : AHB1 clock disable

This bit can be set in order to further reduce power consumption, when none of the AHB1 peripherals (except those listed hereafter) are used and when their clocks are disabled in RCC_AHB1ENR. When this bit is set, all the AHB1 peripherals clocks are off, except for FLASH, BKPSRAM, ICACHE, DCACHE1 and SRAM1.

0: AHB1 clock enabled, distributed to peripherals according to their dedicated clock enable control bits

1: AHB1 clock disabled

Bit 15 Reserved, must be kept at reset value.

Bits 14:12 DPRE[2:0] : DSI PHY prescaler

This bitfield is set and cleared by software to control the division factor of DSI PHY bus clock (DCLK).

0xx: DCLK not divided

100: DCLK divided by 2

101: DCLK divided by 4

110: DCLK divided by 8

111: DCLK divided by 16

Note: This bitfield is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bitfield as reserved and keep it at reset value.

Bit 11 Reserved, must be kept at reset value.

Bits 10:8 PPRE2[2:0] : APB2 prescaler

This bitfield is set and cleared by software to control the division factor of APB2 clock (PCLK2).

0xx: PCLK2 not divided

100: PCLK2 divided by 2

101: PCLK2 divided by 4

110: PCLK2 divided by 8

111: PCLK2 divided by 16

Bit 7 Reserved, must be kept at reset value.

Bits 6:4 PPRE1[2:0] : APB1 prescaler

This bitfield is set and cleared by software to control the division factor of APB1 clock (PCLK1).

Bits 3:0 HPRE[3:0] : AHB prescaler

This bitfield is set and cleared by software to control the division factor of the AHB clock (HCLK).

Caution: Depending on the device voltage range, the software must set these bits correctly to ensure that the system frequency does not exceed the maximum allowed frequency (for more details, refer to Table 114 ). After a write operation to these bits and before decreasing the voltage range, this register must be read to be sure that the new value is taken into account.

11.8.8 RCC clock configuration register 3 (RCC_CFGR3)

Address offset: 0x024

Reset value: 0x0000 0000

Access: word, half-word, and byte access

From 0 to 15 wait states are inserted if the access occurs when the APB or AHB prescalers values update is on going.

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.APB3D
IS
AHB3D
IS
rwrw
1514131211109876543210
Res.Res.Res.Res.Res.Res.Res.Res.Res.PPRE3[2:0]Res.Res.Res.Res.
rwrwrw

Bits 31:18 Reserved, must be kept at reset value.

Bit 17 APB3DIS : APB3 clock disable

This bit can be set in order to further reduce power consumption, when none of the APB3 peripherals from RCC_APB3ENR are used and when their clocks are disabled in RCC_APB3ENR. When this bit is set, all the APB3 peripherals clocks are off.

0: APB3 clock enabled, distributed to peripherals according to their dedicated clock enable control bits

1: APB3 clock disabled

Bit 16 AHB3DIS : AHB3 clock disable

This bit can be set in order to further reduce power consumption, when none of the AHB3 peripherals (except SRAM4) are used and when their clocks are disabled in RCC_AHB3ENR. When this bit is set, all the AHB3 peripherals clocks are off, except for SRAM4.

0: AHB3 clock enabled, distributed to peripherals according to their dedicated clock enable control bits

1: AHB3 clock disabled

Bits 15:7 Reserved, must be kept at reset value.

Bits 6:4 PPRE3[2:0] : APB3 prescaler

This bitfield is set and cleared by software to control the division factor of the APB3 clock (PCLK3).

0xx: HCLK not divided

100: HCLK divided by 2

101: HCLK divided by 4

110: HCLK divided by 8

111: HCLK divided by 16

Bits 3:0 Reserved, must be kept at reset value.

11.8.9 RCC PLL1 configuration register (RCC_PLL1CFGR)

Address offset: 0x028

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.PLL1R
EN
PLL1Q
EN
PLL1P
EN
rwrwrw
1514131211109876543210
PLL1MBOOST[3:0]PLL1M[3:0]Res.Res.Res.PLL1F
RACEN
PLL1RGE[1:0]PLL1SRC[1:0]
rwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:19 Reserved, must be kept at reset value.

Bit 18 PLL1REN : PLL1 DIVR divider output enable

This bit is set and reset by software to enable the pll1_r_ck output of the PLL1. To save power, PLL1RENPLL2REN and PLL1R bits must be set to 0 when pll1_r_ck is not used. This bit can be cleared only when the PLL1 is not used as SYSCLK.

0: pll1_r_ck output disabled

1: pll1_r_ck output enabled

Bit 17 PLL1QEN : PLL1 DIVQ divider output enable

This bit is set and reset by software to enable the pll1_q_ck output of the PLL1. To save power, PLL1QEN and PLL1Q bits must be set to 0 when pll1_q_ck is not used.

0: pll1_q_ck output disabled

1: pll1_q_ck output enabled

Bit 16 PLL1PEN : PLL1 DIVP divider output enable

This bit is set and reset by software to enable the pll1_p_ck output of the PLL1. To save power, PLL1PEN and PLL1P bits must be set to 0 when pll1_p_ck is not used.

0: pll1_p_ck output disabled

1: pll1_p_ck output enabled

Bits 15:12 PLL1MBOOST[3:0] : Prescaler for EPOD booster input clock

This bitfield is set and cleared by software to configure the prescaler of the PLL1, used for the EPOD booster. The EPOD booster input frequency is PLL1 input clock frequency/PLL1MBOOST.

This bit can be written only when the PLL1 is disabled (PLL1ON = 0 and PLL1RDY = 0) and EPODboost mode is disabled (see Section 10: Power control (PWR) ).

0000: division by 1 (bypass)

0001: division by 2

0010: division by 4

0011: division by 6

0100: division by 8

0101: division by 10

0110: division by 12

0111: division by 14

1000: division by 16

others: reserved

Bits 11:8 PLL1M[3:0] : Prescaler for PLL1

This bitfield is set and cleared by software to configure the prescaler of the PLL1. The VCO1 input frequency is PLL1 input clock frequency/PLL1M.

This bit can be written only when the PLL1 is disabled (PLL1ON = 0 and PLL1RDY = 0).

0000: division by 1 (bypass)

0001: division by 2

0010: division by 3

...

1111: division by 16

Bits 7:5 Reserved, must be kept at reset value.

Bit 4 PLL1FRACEN : PLL1 fractional latch enable

This bit is set and reset by software to latch the content of PLL1FRACN in the \( \Sigma\Delta \) modulator.

In order to latch the PLL1FRACN value into the \( \Sigma\Delta \) modulator, PLL1FRACEN must be set to 0, then set to 1: the transition 0 to 1 transfers the content of PLL1FRACN into the modulator (see PLL initialization phase for details).

Bits 3:2 PLL1RGE[1:0] : PLL1 input frequency range

This bit is set and reset by software to select the proper reference frequency range used for PLL1. It must be written before enabling the PLL1.

00-01-10: PLL1 input (ref1_ck) clock range frequency between 4 and 8 MHz

11: PLL1 input (ref1_ck) clock range frequency between 8 and 16 MHz

Bits 1:0 PLL1SRC[1:0] : PLL1 entry clock source

This bitfield is set and cleared by software to select PLL1 clock source. It can be written only when the PLL1 is disabled. In order to save power, when no PLL1 is used, this bitfield value must be zero.

00: No clock sent to PLL1

01: MSIS clock selected as PLL1 clock entry

10: HSI16 clock selected as PLL1 clock entry

11: HSE clock selected as PLL1 clock entry

11.8.10 RCC PLL2 configuration register (RCC_PLL2CFGR)

Address offset: 0x02C

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.PLL2R
EN
PLL2Q
EN
PLL2P
EN
rwrwrw
1514131211109876543210
Res.Res.Res.Res.PLL2M[3:0]Res.Res.Res.PLL2F
RACEN
PLL2RGE[1:0]PLL2SRC[1:0]
rwrwrwrwrwrwrwrwrw

Bits 31:19 Reserved, must be kept at reset value.

Bit 18 PLL2REN : PLL2 DIVR divider output enable

This bit is set and reset by software to enable the pll2_r_ck output of the PLL2. To save power, PLL2REN and PLL2R bits must be set to 0 when pll2_r_ck is not used.

0: pll2_r_ck output disabled

1: pll2_r_ck output enabled

Bit 17 PLL2QEN : PLL2 DIVQ divider output enable

This bit is set and reset by software to enable the pll2_q_ck output of the PLL2. To save power, PLL2QEN and PLL2Q bits must be set to 0 when pll2_q_ck is not used.

0: pll2_q_ck output disabled

1: pll2_q_ck output enabled

Bit 16 PLL2PEN : PLL2 DIVP divider output enable

This bit is set and reset by software to enable the pll2_p_ck output of the PLL2. To save power, PLL2PEN and PLL2P bits must be set to 0 when pll2_p_ck is not used.

0: pll2_p_ck output disabled

1: pll2_p_ck output enabled

Bits 15:12 Reserved, must be kept at reset value.

Bits 11:8 PLL2M[3:0] : Prescaler for PLL2

This bitfield is set and cleared by software to configure the prescaler of the PLL2. The VCO2 input frequency is PLL2 input clock frequency/PLL2M.

This bit can be written only when the PLL2 is disabled (PLL2ON = 0 and PLL2RDY = 0).

0000: division by 1 (bypass)

0001: division by 2

0010: division by 3

...

1111: division by 16

Bits 7:5 Reserved, must be kept at reset value.

Bit 4 PLL2FRACEN : PLL2 fractional latch enable

This bit is set and reset by software to latch the content of PLL2FRACN in the \( \Sigma\Delta \) modulator. In order to latch the PLL2FRACN value into the \( \Sigma\Delta \) modulator, PLL2FRACEN must be set to 0, then set to 1: the transition 0 to 1 transfers the content of PLL2FRACN into the modulator (see PLL initialization phase for details).

Bits 3:2 PLL2RGE[1:0] : PLL2 input frequency range

This bitfield is set and reset by software to select the proper reference frequency range used for PLL2. It must be written before enabling the PLL2.

00-01-10: PLL2 input (ref2_ck) clock range frequency between 4 and 8 MHz

11: PLL2 input (ref2_ck) clock range frequency between 8 and 16 MHz

Bits 1:0 PLL2SRC[1:0] : PLL2 entry clock source

This bitfield is set and cleared by software to select PLL2 clock source. It can be written only when the PLL2 is disabled. To save power, when no PLL2 is used, this bitfield value must be zero.

00: No clock sent to PLL2

01: MSIS clock selected as PLL2 clock entry

10: HSI16 clock selected as PLL2 clock entry

11: HSE clock selected as PLL2 clock entry

11.8.11 RCC PLL3 configuration register (RCC_PLL3CFGR)

Address offset: 0x030

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.PLL3R ENPLL3Q ENPLL3P EN
rwrwrw
1514131211109876543210
Res.Res.Res.Res.PLL3M[3:0]Res.Res.Res.PLL3F RACENPLL3RGE[1:0]PLL3SRC[1:0]
rwrwrwrwrwrwrwrwrw

Bits 31:19 Reserved, must be kept at reset value.

Bit 18 PLL3REN : PLL3 DIVR divider output enable

This bit is set and reset by software to enable the pll3_r_ck output of the PLL3. To save power, PLL3REN and PLL3R bits must be set to 0 when pll3_r_ck is not used.

0: pll3_r_ck output disabled
1: pll3_r_ck output enabled

Bit 17 PLL3QEN : PLL3 DIVQ divider output enable

This bit is set and reset by software to enable the pll3_q_ck output of the PLL3. To save power, PLL3QEN and PLL3Q bits must be set to 0 when pll3_q_ck is not used.

0: pll3_q_ck output disabled
1: pll3_q_ck output enabled

Bit 16 PLL3PEN : PLL3 DIVP divider output enable

This bit is set and reset by software to enable the pll3_p_ck output of the PLL3. To save power, PLL3PEN and PLL3P bits must be set to 0 when pll3_p_ck is not used.

0: pll3_p_ck output disabled
1: pll3_p_ck output enabled

Bits 15:12 Reserved, must be kept at reset value.

Bits 11:8 PLL3M[3:0] : Prescaler for PLL3

This bitfield is set and cleared by software to configure the prescaler of the PLL3. The VCO3 input frequency is PLL3 input clock frequency/PLL3M. This bitfield can be written only when the PLL3 is disabled (PLL3ON = 0 and PLL3RDY = 0).

0000: division by 1 (bypass)
0001: division by 2
0010: division by 3
...
1111: division by 16

Bits 7:5 Reserved, must be kept at reset value.

Bit 4 PLL3FRACEN : PLL3 fractional latch enable

This bit is set and reset by software to latch the content of PLL3FRACN in the \( \Sigma\Delta \) modulator. In order to latch the PLL3FRACN value into the \( \Sigma\Delta \) modulator, PLL3FRACEN must be set to 0, then set to 1: the transition 0 to 1 transfers the content of PLL3FRACN into the modulator (see PLL initialization phase for details).

Bits 3:2 PLL3RGE[1:0] : PLL3 input frequency range

This bit is set and reset by software to select the proper reference frequency range used for PLL3. It must be written before enabling the PLL3.

00-01-10: PLL3 input (ref3_ck) clock range frequency between 4 and 8 MHz
11: PLL3 input (ref3_ck) clock range frequency between 8 and 16 MHz

Bits 1:0 PLL3SRC[1:0] : PLL3 entry clock source

This bitfield is set and cleared by software to select PLL3 clock source. It can be written only when the PLL3 is disabled. To save power, when no PLL3 is used, this bitfield value must be zero.

00: No clock sent to PLL3
01: MSIS clock selected as PLL3 clock entry
10: HSI16 clock selected as PLL3 clock entry
11: HSE clock selected as PLL3 clock entry

11.8.12 RCC PLL1 dividers register (RCC_PLL1DIVR)

Address offset: 0x034

Reset value: 0x0101 0280

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.PLL1R[6:0]Res.PLL1Q[6:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrw
1514131211109876543210
PLL1P[6:0]PLL1N[8:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrwrwrw

Bit 31 Reserved, must be kept at reset value.

Bits 30:24 PLL1R[6:0] : PLL1 DIVR division factor

This bitfield is set and reset by software to control frequency of the pll1_r_ck clock. It can be written only when the PLL1 is disabled (PLL1ON = 0 and PLL1RDY = 0). Only division by one and even division factors are allowed.

0000000: pll1_r_ck = vco1_ck

0000001: pll1_r_ck = vco1_ck / 2 (default after reset)

0000010: reserved

0000011: pll1_r_ck = vco1_ck / 4

...

1111111: pll1_r_ck = vco1_ck / 128

Bit 23 Reserved, must be kept at reset value.

Bits 22:16 PLL1Q[6:0] : PLL1 DIVQ division factor

This bitfield is set and reset by software to control the frequency of the pll1_q_ck clock. It can be written only when the PLL1 is disabled (PLL1ON = 0 and PLL1RDY = 0).

0000000: pll1_q_ck = vco1_ck

0000001: pll1_q_ck = vco1_ck / 2 (default after reset)

0000010: pll1_q_ck = vco1_ck / 3

0000011: pll1_q_ck = vco1_ck / 4

...

1111111: pll1_q_ck = vco1_ck / 128

Bits 15:9 PLL1P[6:0] : PLL1 DIVP division factor

This bitfield is set and reset by software to control the frequency of the pll1_p_ck clock. It can be written only when the PLL1 is disabled (PLL1ON = 0 and PLL1RDY = 0).

0000000: pll1_p_ck = vco1_ck

0000001: pll1_p_ck = vco1_ck / 2 (default after reset)

0000010: pll1_p_ck = vco1_ck / 3

0000011: pll1_p_ck = vco1_ck / 4

...

1111111: pll1_p_ck = vco1_ck / 128

Bits 8:0 PLL1N[8:0] : Multiplication factor for PLL1 VCO

This bitfield is set and reset by software to control the multiplication factor of the VCO. It can be written only when the PLL is disabled (PLL1ON = 0 and PLL1RDY = 0).

0x003: PLL1N = 4

0x004: PLL1N = 5

0x005: PLL1N = 6

...

0x080: PLL1N = 129 (default after reset)

...

0x1FF: PLL1N = 512

Others: reserved

VCO output frequency = \( F_{ref1\_ck} \times PLL1N \) , when fractional value 0 has been loaded in PLL1FRACN, with:

11.8.13 RCC PLL1 fractional divider register (RCC_PLL1FRAGR)

Address offset: 0x038

Reset value: 0x0000 0000

Access: no wait state; word and half-word access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
PLL1FRACN[12:0]Res.Res.Res.
rwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:16 Reserved, must be kept at reset value.

Bits 15:3 PLL1FRACN[12:0] : Fractional part of the multiplication factor for PLL1 VCO

This bitfield is set and reset by software to control the fractional part of the VCO multiplication factor. It can be written at any time, allowing dynamic fine-tuning of the PLL1 VCO.

VCO output frequency = \( F_{ref1\_ck} \times (PLL1N + (PLL1FRACN / 2^{13})) \) , with:

To change the FRACN value on-the-fly even if the PLL is enabled, the application must proceed as follows:

Bits 2:0 Reserved, must be kept at reset value.

11.8.14 RCC PLL2 dividers configuration register (RCC_PLL2DIVR)

Address offset: 0x03C

Reset value: 0x0101 0280

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.PLL2R[6:0]Res.PLL2Q[6:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrw
1514131211109876543210
PLL2P[6:0]PLL2N[8:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrwrwrw

Bit 31 Reserved, must be kept at reset value.

Bits 30:24 PLL2R[6:0] : PLL2 DIVR division factor

This bitfield is set and reset by software to control the frequency of the pll2_r_ck clock. It can be written only when the PLL2 is disabled (PLL2ON = 0 and PLL2RDY = 0).

0000000: pll2_r_ck = vco2_ck

0000001: pll2_r_ck = vco2_ck / 2 (default after reset)

0000010: pll2_r_ck = vco2_ck / 3

0000011: pll2_r_ck = vco2_ck / 4

...

1111111: pll2_r_ck = vco2_ck / 128

Bit 23 Reserved, must be kept at reset value.

Bits 22:16 PLL2Q[6:0] : PLL2 DIVQ division factor

This bitfield is set and reset by software to control the frequency of the pll2_q_ck clock. It can be written only when the PLL2 is disabled (PLL2ON = 0 and PLL2RDY = 0).

0000000: pll2_q_ck = vco2_ck

0000001: pll2_q_ck = vco2_ck / 2 (default after reset)

0000010: pll2_q_ck = vco2_ck / 3

0000011: pll2_q_ck = vco2_ck / 4

...

1111111: pll2_q_ck = vco2_ck / 128

Bits 15:9 PLL2P[6:0] : PLL2 DIVP division factor

This bitfield is set and reset by software to control the frequency of the pll2_p_ck clock. It can be written only when the PLL2 is disabled (PLL2ON = 0 and PLL2RDY = 0).

0000000: pll2_p_ck = vco2_ck

0000001: pll2_p_ck = vco2_ck / 2 (default after reset)

0000010: pll2_p_ck = vco2_ck / 3

0000011: pll2_p_ck = vco2_ck / 4

...

1111111: pll2_p_ck = vco2_ck / 128

Bits 8:0 PLL2N[8:0] : Multiplication factor for PLL2 VCO

This bitfield is set and reset by software to control the multiplication factor of the VCO. It can be written only when the PLL is disabled (PLL2ON = 0 and PLL2RDY = 0).

0x003: PLL2N = 4

0x004: PLL2N = 5

0x005: PLL2N = 6

...

0x080: PLL2N = 129 (default after reset)

...

0x1FF: PLL2N = 512

Others: reserved

VCO output frequency = \( F_{ref2\_ck} \times PLL2N \) , when fractional value 0 has been loaded in PLL2FRACN, with:

11.8.15 RCC PLL2 fractional divider register (RCC_PLL2FRACR)

Address offset: 0x040

Reset value: 0x0000 0000

Access: no wait state; word and half-word access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
PLL2FRACN[12:0]Res.Res.Res.
rwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:16 Reserved, must be kept at reset value.

Bits 15:3 PLL2FRACN[12:0] : Fractional part of the multiplication factor for PLL2 VCO

This bitfield is set and reset by software to control the fractional part of the VCO multiplication factor. It can be written at any time, allowing dynamic fine-tuning of the PLL2 VCO.

VCO output frequency = \( F_{ref2\_ck} \times (PLL2N + (PLL2FRACN / 2^{13})) \) , with

In order to change the FRACN value on-the-fly even if the PLL is enabled, the application must proceed as follows:

Bits 2:0 Reserved, must be kept at reset value.

11.8.16 RCC PLL3 dividers configuration register (RCC_PLL3DIVR)

Address offset: 0x0444

Reset value: 0x0101 0280

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.PLL3R[6:0]Res.PLL3Q[6:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrw
1514131211109876543210
PLL3P[6:0]PLL3N[8:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrwrwrw

Bit 31 Reserved, must be kept at reset value.

Bits 30:24 PLL3R[6:0] : PLL3 DIVR division factor

This bitfield is set and reset by software to control the frequency of the pll3_r_ck clock. It can be written only when the PLL3 is disabled (PLL3ON = 0 and PLL3RDY = 0).

0000000: pll3_r_ck = vco3_ck

0000001: pll3_r_ck = vco3_ck / 2 (default after reset)

0000010: pll3_r_ck = vco3_ck / 3

0000011: pll3_r_ck = vco3_ck / 4

...

1111111: pll3_r_ck = vco3_ck / 128

Bit 23 Reserved, must be kept at reset value.

Bits 22:16 PLL3Q[6:0] : PLL3 DIVQ division factor

This bitfield is set and reset by software to control the frequency of the pll3_q_ck clock. It can be written only when the PLL3 is disabled (PLL3ON = 0 and PLL3RDY = 0).

0000000: pll3_q_ck = vco3_ck

0000001: pll3_q_ck = vco3_ck / 2 (default after reset)

0000010: pll3_q_ck = vco3_ck / 3

0000011: pll3_q_ck = vco3_ck / 4

...

1111111: pll3_q_ck = vco3_ck / 128

Bits 15:9 PLL3P[6:0] : PLL3 DIVP division factor

This bitfield is set and reset by software to control the frequency of the pll3_p_ck clock. It can be written only when the PLL3 is disabled (PLL3ON = 0 and PLL3RDY = 0).

0000000: pll3_p_ck = vco3_ck

0000001: pll3_p_ck = vco3_ck / 2 (default after reset)

0000010: pll3_p_ck = vco3_ck / 3

0000011: pll3_p_ck = vco3_ck / 4

...

1111111: pll3_p_ck = vco3_ck / 128

Bits 8:0 PLL3N[8:0] : Multiplication factor for PLL3 VCO

This bitfield is set and reset by software to control the multiplication factor of the VCO. It can be written only when the PLL is disabled (PLL3ON = 0 and PLL3RDY = 0).

0x003: PLL3N = 4

0x004: PLL3N = 5

0x005: PLL3N = 6

...

0x080: PLL3N = 129 (default after reset)

...

0x1FF: PLL3N = 512

Others: reserved

VCO output frequency = \( F_{ref3\_ck} \times PLL3N \) , when fractional value 0 has been loaded in PLL3FRACN, with:

11.8.17 RCC PLL3 fractional divider register (RCC_PLL3FRACR)

Address offset: 0x048

Reset value: 0x0000 0000

Access: no wait state; word and half-word access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
PLL3FRACN[12:0]Res.Res.Res.
rwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:16 Reserved, must be kept at reset value.

Bits 15:3 PLL3FRACN[12:0] : Fractional part of the multiplication factor for PLL3 VCO

This bitfield is set and reset by software to control the fractional part of the VCO multiplication factor. It can be written at any time, allowing dynamic fine-tuning of the PLL3 VCO.

VCO output frequency = \( F_{ref3\_ck} \times (PLL3N + (PLL3FRACN / 2^{13})) \) , with:

In order to change the FRACN value on-the-fly even if the PLL is enabled, the application must proceed as follows:

Bits 2:0 Reserved, must be kept at reset value.

11.8.18 RCC clock interrupt enable register (RCC_CIER)

Address offset: 0x050

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.SHSIRDYIEMSIKRDYIERes.Res.PLL3RDYIEPLL2RDYIEPLL1RDYIEHSI48RDYIEHSERDYIEHSIRDYIEMSISR
DYIE
LSERDYIELSIRDI
DYIE
rwrwrwrwrwrwrwrwrwrwrw

Bits 31:13 Reserved, must be kept at reset value.

Bit 12 SHSIRDYIE : SHSI ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by the SHSI oscillator stabilization.

0: SHSI ready interrupt disabled

1: SHSI ready interrupt enabled

Bit 11 MSIKRDYIE : MSIK ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by the MSIK oscillator stabilization.

0: MSIK ready interrupt disabled

1: MSIK ready interrupt enabled

Bits 10:9 Reserved, must be kept at reset value.

Bit 8 PLL3RDYIE : PLL3 ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by PLL3 lock.

0: PLL3 lock interrupt disabled

1: PLL3 lock interrupt enabled

Bit 7 PLL2RDYIE : PLL2 ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by PLL2 lock.

0: PLL2 lock interrupt disabled

1: PLL2 lock interrupt enabled

Bit 6 PLL1RDYIE : PLL ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by PLL1 lock.

0: PLL1 lock interrupt disabled

1: PLL1 lock interrupt enabled

Bit 5 HSI48RDYIE : HSI48 ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by the HSI48 oscillator stabilization.

0: HSI48 ready interrupt disabled

1: HSI48 ready interrupt enabled

Bit 4 HSERDYIE : HSE ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by the HSE oscillator stabilization.

0: HSE ready interrupt disabled

1: HSE ready interrupt enabled

Bit 3 HSIRDYIE : HSI16 ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by the HSI16 oscillator stabilization.

0: HSI16 ready interrupt disabled

1: HSI16 ready interrupt enabled

Bit 2 MSISRDYIE : MSIS ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by the MSIS oscillator stabilization.

0: MSIS ready interrupt disabled

1: MSIS ready interrupt enabled

Bit 1 LSERDYIE : LSE ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by the LSE oscillator stabilization.

0: LSE ready interrupt disabled

1: LSE ready interrupt enabled

Bit 0 LSIRDYIE : LSI ready interrupt enable

This bit is set and cleared by software to enable/disable interrupt caused by the LSI oscillator stabilization.

0: LSI ready interrupt disabled

1: LSI ready interrupt enabled

11.8.19 RCC clock interrupt flag register (RCC_CIFR)

Address offset: 0x054

Reset value: 0x0000 0000

Access: no wait state, word; half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.SHSIR
DYF
MSIKR
DYF
CSSFRes.PLL3R
DYF
PLL2R
DYF
PLL1R
DYF
HSI48R
DYF
HSERD
YF
HSIRD
YF
MSISR
DYF
LSERD
YF
LSIRD
YF
rrrrrrrrrrrr

Bits 31:13 Reserved, must be kept at reset value.

Bit 12 SHSIRDYF : SHSI ready interrupt flag

This bit is set by hardware when the SHSI clock becomes stable and SHSIRDYIE is set. It is cleared by software by setting the SHSIRDYC bit.

0: No clock ready interrupt caused by the SHSI oscillator

1: Clock ready interrupt caused by the SHSI oscillator

Bit 11 MSIKRDYF: MSIK ready interrupt flag

This bit is set by hardware when the MSIK clock becomes stable and MSIKRDYIE is set. It is cleared by software by setting the MSIKRDYC bit.

0: No clock ready interrupt caused by the MSIK oscillator

1: Clock ready interrupt caused by the MSIK oscillator

Bit 10 CSSF: Clock security system interrupt flag

This bit is set by hardware when a failure is detected in the HSE oscillator. It is cleared by software by setting the CSSC bit.

0: No clock security interrupt caused by HSE clock failure

1: Clock security interrupt caused by HSE clock failure

Bit 9 Reserved, must be kept at reset value.

Bit 8 PLL3RDYF: PLL3 ready interrupt flag

This bit is set by hardware when the PLL3 locks and PLL3RDYIE is set. It is cleared by software by setting the PLL3RDYC bit.

0: No clock ready interrupt caused by PLL3 lock

1: Clock ready interrupt caused by PLL3 lock

Bit 7 PLL2RDYF: PLL2 ready interrupt flag

This bit is set by hardware when the PLL2 locks and PLL2RDYIE is set. It is cleared by software by setting the PLL2RDYC bit.

0: No clock ready interrupt caused by PLL2 lock

1: Clock ready interrupt caused by PLL2 lock

Bit 6 PLL1RDYF: PLL1 ready interrupt flag

This bit is set by hardware when the PLL1 locks and PLL1RDYIE is set. It is cleared by software by setting the PLL1RDYC bit.

0: No clock ready interrupt caused by PLL1 lock

1: Clock ready interrupt caused by PLL1 lock

Bit 5 HSI48RDYF: HSI48 ready interrupt flag

This bit is set by hardware when the HSI48 clock becomes stable and HSI48RDYIE is set. It is cleared by software by setting the HSI48RDYC bit.

0: No clock ready interrupt caused by the HSI48 oscillator

1: Clock ready interrupt caused by the HSI48 oscillator

Bit 4 HSERDYF: HSE ready interrupt flag

This bit is set by hardware when the HSE clock becomes stable and HSERDYIE is set. It is cleared by software by setting the HSERDYC bit.

0: No clock ready interrupt caused by the HSE oscillator

1: Clock ready interrupt caused by the HSE oscillator

Bit 3 HSIRDYF: HSI16 ready interrupt flag

This bit is set by hardware when the HSI16 clock becomes stable and HSIRDYIE = 1 in response to setting the HSION (see RCC_CR). When HSION = 0 but the HSI16 oscillator is enabled by the peripheral through a clock request, this bit is not set and no interrupt is generated. This bit is cleared by software by setting the HSIRDYC bit.

0: No clock ready interrupt caused by the HSI16 oscillator

1: Clock ready interrupt caused by the HSI16 oscillator

Bit 2 MSISRDYF: MSIS ready interrupt flag

This bit is set by hardware when the MSIS clock becomes stable and MSISRDYIE is set. It is cleared by software by setting the MSISRDYC bit.

0: No clock ready interrupt caused by the MSIS oscillator

1: Clock ready interrupt caused by the MSIS oscillator

Bit 1 LSERDYF : LSE ready interrupt flag

This bit is set by hardware when the LSE clock becomes stable and LSERDYIE is set. It is cleared by software by setting the LSERDYC bit.

0: No clock ready interrupt caused by the LSE oscillator

1: Clock ready interrupt caused by the LSE oscillator

Bit 0 LSIRDYF : LSI ready interrupt flag

This bit is set by hardware when the LSI clock becomes stable and LSIRDYIE is set. It is cleared by software by setting the LSIRDYC bit.

0: No clock ready interrupt caused by the LSI oscillator

1: Clock ready interrupt caused by the LSI oscillator

11.8.20 RCC clock interrupt clear register (RCC_CICR)

Address offset: 0x058

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.SHSIR
DYC
MSIKR
DYC
CSSCRes.PLL3R
DYC
PLL2R
DYC
PLL1R
DYC
HSI48R
DYC
HSERD
YC
HSIRD
YC
MSISR
DYC
LSERD
YC
LSIRD
YC
wwwwwwwwwwww

Bits 31:13 Reserved, must be kept at reset value.

Bit 12 SHSIRDYC : SHSI oscillator ready interrupt clear

Writing this bit to 1 clears the SHSIRDYF flag. Writing 0 has no effect.

Bit 11 MSIKRDYC : MSI oscillator ready interrupt clear

Writing this bit to 1 clears the MSIKRDYF flag. Writing 0 has no effect.

Bit 10 CSSC : Clock security system interrupt clear

Writing this bit to 1 clears the CSSF flag. Writing 0 has no effect.

Bit 9 Reserved, must be kept at reset value.

Bit 8 PLL3RDYC : PLL3 ready interrupt clear

Writing this bit to 1 clears the PLL3RDYF flag. Writing 0 has no effect.

Bit 7 PLL2RDYC : PLL2 ready interrupt clear

Writing this bit to 1 clears the PLL2RDYF flag. Writing 0 has no effect.

Bit 6 PLL1RDYC : PLL1 ready interrupt clear

Writing this bit to 1 clears the PLL1RDYF flag. Writing 0 has no effect.

Bit 5 HSI48RDYC : HSI48 ready interrupt clear

Writing this bit to 1 clears the HSI48RDYF flag. Writing 0 has no effect.

Bit 4 HSERDYC : HSE ready interrupt clear

Writing this bit to 1 clears the HSERDYF flag. Writing 0 has no effect.

Bit 3 HSIRDYC : HSI16 ready interrupt clear

Writing this bit to 1 clears the HSIRDYF flag. Writing 0 has no effect.

Bit 2 MSISRDYC : MSIS ready interrupt clear

Writing this bit to 1 clears the MSISRDYF flag. Writing 0 has no effect.

Bit 1 LSERDYC : LSE ready interrupt clear

Writing this bit to 1 clears the LSERDYF flag. Writing 0 has no effect.

Bit 0 LSIRDYC : LSI ready interrupt clear

Writing this bit to 1 clears the LSIRDF flag. Writing 0 has no effect.

11.8.21 RCC AHB1 peripheral reset register (RCC_AHB1RSTR)

Address offset: 0x060

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.GPU2D
RST
GFXM
MURS
T
DMA2D
RST
RAMC
FGRST
TSCRS
T
rwrwrwrwrw
1514131211109876543210
JPEGR
ST
Res.Res.RCR
ST
Res.Res.Res.Res.Res.Res.Res.Res.MDF1R
ST
FMAC
RST
CORDI
CRST
GPDM
A1RST
rwrwrwrwrwrw

Bits 31:21 Reserved, must be kept at reset value.

Bit 20 GPU2DRST : GPU2D reset

This bit is set and cleared by software.

0: No effect

1: Reset the GPU2D.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 19 GFXMMURST : GFXMMU reset

This bit is set and cleared by software.

0: No effect

1: Reset the GFXMMU.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 18 DMA2DRST : DMA2D reset

This bit is set and cleared by software.

0: No effect

1: Reset the DMA2D.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 17 RAMCFG_RST : RAMCFG reset

This bit is set and cleared by software.

0: No effect

1: Reset the RAMCFG.

Bit 16 TSCRST : TSC reset

This bit is set and cleared by software.

0: No effect

1: Reset the TSC.

Bit 15 JPEGRST : JPEG reset

This bit is set and cleared by software.

0: No effect

1: Reset the JPEG.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 14:13 Reserved, must be kept at reset value.

Bit 12 CCRCRST : CRC reset

This bit is set and cleared by software.

0: No effect

1: Reset the CRC.

Bits 11:4 Reserved, must be kept at reset value.

Bit 3 MDF1RST : MDF1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the MDF1.

Bit 2 FMACRST : FMAC reset

This bit is set and cleared by software.

0: No effect

1: Reset the FMAC.

Bit 1 CORDICRST : CORDIC reset

This bit is set and cleared by software.

0: No effect

1: Reset the CORDIC.

Bit 0 GPDMA1RST : GPDMA1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the GPDMA1.

11.8.22 RCC AHB2 peripheral reset register 1 (RCC_AHB2RSTR1)

Address offset: 0x064

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.SDMMC
C2RST
SDMMC
C1RST
Res.Res.OTFDEC
C2RST
OTFDEC
C1RST
Res.OCTOS
PIMRS
T
SAESR
ST
PKARS
T
RNGR
ST
HASHR
ST
AESRS
T
1514131211109876543210
Res.OTGR
ST
Res.DCMI
PSSIR
ST
Res.ADC12
RST
GPIOJ
RST
GPIOI
ST
GPIOH
RST
GPIOG
RST
GPIOF
RST
GPIOE
RST
GPIO
D
RST
GPIO
C
RST
GPIO
B
RST
GPIO
A
RST
rwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:29 Reserved, must be kept at reset value.

Bit 28 SDMMC2RST : SDMMC2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the SDMMC2.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 27 SDMMC1RST : SDMMC1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the SDMMC1.

Bits 26:25 Reserved, must be kept at reset value.

Bit 24 OTFDEC2RST : OTFDEC2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the OTFDEC2.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 23 OTFDEC1RST : OTFDEC1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the OTFDEC1.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 22 Reserved, must be kept at reset value.

Bit 21 OCTOSPIMRST : OCTOSPIM reset

This bit is set and cleared by software.

0: No effect

1: Reset the OCTOSPIM.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 20 SAESRST : SAES hardware accelerator reset

This bit is set and cleared by software.

0: No effect

1: Reset the SAES.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 19 PKARST : PKA reset

This bit is set and cleared by software.

0: No effect

1: Reset the PKA.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 18 RNGRST : RNG reset

This bit is set and cleared by software.

0: No effect

1: Reset the RNG.

Bit 17 HASHRST : HASH reset

This bit is set and cleared by software.

0: No effect

1: Reset the HASH.

Bit 16 AESRST : AES hardware accelerator reset

This bit is set and cleared by software.

0: No effect

1: Reset the AES.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 15 Reserved, must be kept at reset value.

Bit 14 OTGRST : OTG_FS or OTG_HS reset

This bit is set and cleared by software.

0: No effect

1: Reset the OTG_FS or OTG_HS.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 13 Reserved, must be kept at reset value.

Bit 12 DCMI_PSSIRST : DCMI and PSSI reset

This bit is set and cleared by software.

0: No effect

1: Reset the DCMI and PSSI.

Bit 11 Reserved, must be kept at reset value.

Bit 10 ADC12RST : ADC1 and ADC2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the ADC1 and ADC2.

Note: This bit impacts ADC1 in STM32U535/545/575/585, and ADC1/ADC2 in STM32U59x/5Ax/5Fx/5Gx.

Bit 9 GPIOJRST : I/O port J reset

This bit is set and cleared by software.

0: No effect

1: Reset the I/O port J.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 8 GPIOIRST : I/O port I reset

This bit is set and cleared by software.

0: No effect

1: Reset the I/O port I.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 7 GPIOHRST : I/O port H reset

This bit is set and cleared by software.

0: No effect

1: Reset the I/O port H.

Bit 6 GPIOGRST : I/O port G reset

This bit is set and cleared by software.

0: No effect

1: Reset the I/O port G.

Bit 5 GPIOFRST : I/O port F reset

This bit is set and cleared by software.

0: No effect

1: Reset I/O port F

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral.
If not present, consider this bit as reserved and keep it at reset value.

Bit 4 GPIOERST : I/O port E reset

This bit is set and cleared by software.

0: No effect

1: Reset the I/O port E.

Bit 3 GPIODRST : I/O port D reset

This bit is set and cleared by software.

0: No effect

1: Reset the I/O port D.

Bit 2 GPIOCRST : I/O port C reset

This bit is set and cleared by software.

0: No effect

1: Reset the I/O port C.

Bit 1 GPIOBRST : I/O port B reset

This bit is set and cleared by software.

0: No effect

1: Reset the I/O port B.

Bit 0 GPIOARST : I/O port A reset

This bit is set and cleared by software.

0: No effect

1: Reset the I/O port A.

11.8.23 RCC AHB2 peripheral reset register 2 (RCC_AHB2RSTR2)

Address offset: 0x068

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.HSPI1RSTRes.Res.Res.OCTOSPI2RSTRes.Res.Res.OCTOSPI1RSTRes.Res.Res.FSMC RST
rwrwrwrw

Bits 31:13 Reserved, must be kept at reset value.

Bit 12 HSPI1RST : HSPI1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the HSPI1.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 11:9 Reserved, must be kept at reset value.

Bit 8 OCTOSPI2RST : OCTOSPI2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the OCTOSPI2.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 7:5 Reserved, must be kept at reset value.

Bit 4 OCTOSPI1RST : OCTOSPI1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the OCTOSPI1.

Bits 3:1 Reserved, must be kept at reset value.

Bit 0 FSMCRST : Flexible memory controller reset

This bit is set and cleared by software.

0: No effect

1: Reset the FSMC

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

11.8.24 RCC AHB3 peripheral reset register (RCC_AHB3RSTR)

Address offset: 0x06C

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.Res.Res.ADF1RSTLPDMA1RSTRes.Res.DAC1RSTADC4RSTRes.Res.Res.Res.LP GPI O1RST
rwrwrwrwrw

Bits 31:11 Reserved, must be kept at reset value.

Bit 10 ADF1RST : ADF1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the ADF1.

Bit 9 LPDMA1RST : LPDMA1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the LPDMA1.

Bits 8:7 Reserved, must be kept at reset value.

Bit 6 DAC1RST : DAC1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the DAC1.

Bit 5 ADC4RST : ADC4 reset

This bit is set and cleared by software.

0: No effect

1: Reset the ADC4 interface.

Bits 4:1 Reserved, must be kept at reset value.

Bit 0 LPGPIO1RST : LPGPIO1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the LPGPIO1.

11.8.25 RCC APB1 peripheral reset register 1 (RCC_APB1RSTR1)

Address offset: 0x074

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.USART6RSTCRSRSTRes.I2C2RSTI2C1RSTUART5RSTUART4RSTUSART3RSTUSART2RSTRes.
rwrwrwrwrwrwrwrw
1514131211109876543210
Res.SPI2RSTRes.Res.Res.Res.Res.Res.Res.Res.TIM7RSTTIM6RSTTIM5RSTTIM4RSTTIM3RSTTIM2RST
rwrwrwrwrwrwrw

Bits 31:26 Reserved, must be kept at reset value.

Bit 25 USART6RST : USART6 reset

This bit is set and cleared by software.

0: No effect

1: Reset the USART6.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 24 CRSRST : CRS reset

This bit is set and cleared by software.

0: No effect

1: Reset the CRS.

Bit 23 Reserved, must be kept at reset value.

Bit 22 I2C2RST : I2C2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the I2C2.

Bit 21 I2C1RST : I2C1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the I2C1.

Bit 20 UART5RST : UART5 reset

This bit is set and cleared by software.

0: No effect

1: Reset the UART5.

Bit 19 UART4RST : UART4 reset

This bit is set and cleared by software.

0: No effect

1: Reset the UART4.

Bit 18 USART3RST : USART3 reset

This bit is set and cleared by software.

0: No effect

1: Reset the USART3.

Bit 17 USART2RST : USART2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the USART2

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 16:15 Reserved, must be kept at reset value.

Bit 14 SPI2RST : SPI2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the SPI2.

Bits 13:6 Reserved, must be kept at reset value.

Bit 5 TIM7RST : TIM7 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM7.

Bit 4 TIM6RST : TIM6 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM6.

Bit 3 TIM5RST : TIM5 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM5.

Bit 2 TIM4RST : TIM4 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM4.

Bit 1 TIM3RST : TIM3 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM3.

Bit 0 TIM2RST : TIM2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM2.

11.8.26 RCC APB1 peripheral reset register 2 (RCC_APB1RSTR2)

Address offset: 0x078

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.UCPD1
RST
Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.Res.Res.Res.FDCAN
1RST
Res.I2C6RS
T
I2C5RS
T
LPTIM2
RST
Res.Res.Res.I2C4RS
T
Res.
rwrwrwrwrw

Bits 31:24 Reserved, must be kept at reset value.

Bit 23 UCPD1RST : UCPD1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the UCPD1.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 22:10 Reserved, must be kept at reset value.

Bit 9 FDCAN1RST : FDCAN1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the FDCAN1.

Note: This bit is only available on some devices in the STM32U5 series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and kept at reset value.

Bit 8 Reserved, must be kept at reset value.

Bit 7 I2C6RST : I2C6 reset

This bit is set and cleared by software

0: No effect

1: Reset the I2C6.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 6 I2C5RST : I2C5 reset

This bit is set and cleared by software

0: No effect

1: Reset the I2C5.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 5 LPTIM2RST : LPTIM2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the LPTIM2.

Bits 4:2 Reserved, must be kept at reset value.

Bit 1 I2C4RST : I2C4 reset

This bit is set and cleared by software

0: No effect

1: Reset the I2C4.

Bit 0 Reserved, must be kept at reset value.

11.8.27 RCC APB2 peripheral reset register (RCC_APB2RSTR)

Address offset: 0x07C

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.DSIRSTLTDCRSTGFXTIMRSTUSBRSRes.SAI2RSTSAI1RSTRes.Res.TIM17RSTTIM16RSTTIM15RST
rwrwrwrwrwrwrwrwrw
1514131211109876543210
Res.USART1RSTTIM8RSTSPI1RSTTIM1RSTRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
rwrwrwrw

Bits 31:28 Reserved, must be kept at reset value.

Bit 27 DSIRST : DSI reset

This bit is set and cleared by software.

0: No effect

1: Reset the DSI.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 26 LTDCRST : LTDC reset

This bit is set and cleared by software.

0: No effect

1: Reset the LTDC.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 25 GFXTIMRST : GFXTIM reset

This bit is set and cleared by software.

0: No effect

1: Reset the GFXTIM.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 24 USBRST : USB reset

This bit is set and cleared by software.

0: No effect

1: Reset the USB.

Note: This bit is only available on STM32U535/545 devices, it is reserved on other devices in the STM32U5 Series. If not present, consider this bit as reserved and keep it at reset value.

Bit 23 Reserved, must be kept at reset value.

Bit 22 SAI2RST : SAI2 reset

This bit is set and cleared by software.

0: No effect

1: Reset the SAI2.

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 21 SAI1RST : SAI1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the SAI1.

Bits 20:19 Reserved, must be kept at reset value.

Bit 18 TIM17RST : TIM17 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM17.

Bit 17 TIM16RST : TIM16 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM16.

Bit 16 TIM15RST : TIM15 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM15.

Bit 15 Reserved, must be kept at reset value.

Bit 14 USART1RST : USART1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the USART1.

Bit 13 TIM8RST : TIM8 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM8.

Bit 12 SPI1RST : SPI1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the SPI1.

Bit 11 TIM1RST : TIM1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the TIM1.

Bits 10:0 Reserved, must be kept at reset value.

11.8.28 RCC APB3 peripheral reset register (RCC_APB3RSTR)

Address offset: 0x080

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.VREFRSTRes.Res.Res.Res.
1514131211109876543210
COMPRSTOPAMP RSTLPTIM4 RSTLPTIM3 RSTLPTIM1 RSTRes.Res.Res.I2C3RSTLPUART1RSTSPI3RSTRes.Res.Res.SYSCFGRSTRes.
rwrwrwrwrwrwrwrwrw

Bits 31:21 Reserved, must be kept at reset value.

Bit 20 VREFRST : VREFBUF reset

This bit is set and cleared by software.

0: No effect

1: Reset the VREFBUF.

Bits 19:16 Reserved, must be kept at reset value.

Bit 15 COMPRST : COMP reset

This bit is set and cleared by software.

0: No effect

1: Reset the COMP.

Bit 14 OPAMP RST : OPAMP reset

This bit is set and cleared by software.

0: No effect

1: Reset the OPAMP.

Bit 13 LPTIM4 RST : LPTIM4 reset

This bit is set and cleared by software.

0: No effect

1: Reset the LPTIM4.

Bit 12 LPTIM3 RST : LPTIM3 reset

This bit is set and cleared by software.

0: No effect

1: Reset the LPTIM3.

Bit 11 LPTIM1 RST : LPTIM1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the LPTIM1.

Bits 10:8 Reserved, must be kept at reset value.

Bit 7 I2C3RST : I2C3 reset

This bit is set and cleared by software.

0: No effect

1: Reset the I2C3.

Bit 6 LPUART1RST : LPUART1 reset

This bit is set and cleared by software.

0: No effect

1: Reset the LPUART1.

Bit 5 SPI3RST : SPI3 reset

This bit is set and cleared by software.

0: No effect

1: Reset the SPI3.

Bits 4:2 Reserved, must be kept at reset value.

Bit 1 SYSCFGRST : SYSCFG reset

This bit is set and cleared by software.

0: No effect

1: Reset the SYSCFG.

Bit 0 Reserved, must be kept at reset value.

11.8.29 RCC AHB1 peripheral clock enable register (RCC_AHB1ENR)

Address offset: 0x088

Reset value: 0xD000 0100 (for STM32U535/545/575/585)

Reset value: 0xD020 0100 (for STM32U59x/5Ax/5Fx/5Gx)

Access: no wait state; word, half-word, and byte access

Note: When the peripheral clock is not active, read or write access to peripheral registers is not supported.

31302928272625242322212019181716
SRAM1ENDCACHE1ENRes.BKPSRAMENRes.Res.Res.GTZC1ENRes.Res.DCACHE2ENGPU2DENGFXMUMENDMA2DENRAMCFGENTSCEN
rwrwrwrwrwrwrwrwrwrw
1514131211109876543210
JPEGENRes.Res.CRCERes.Res.Res.FLASHENRes.Res.Res.Res.MDF1ENFMACECORDICENGPDM1EN
rwrwrwrwrwrwrw

Bit 31 SRAM1EN : SRAM1 clock enable

This bit is set and reset by software.

0: SRAM1 clock disabled

1: SRAM1 clock enabled

Bit 30 DCACHE1EN : DCACHE1 clock enable

This bit is set and reset by software.

0: DCACHE1 clock disabled

1: DCACHE1 clock enabled

Note: DCACHE1 clock must be enabled when external memories are accessed through OCTOSPI1, OCTOSPI2, HSPI1 or FSMC, even if the DCACHE1 is bypassed.

Bit 29 Reserved, must be kept at reset value.

Bit 28 BKPSRAMEN : BKPSRAM clock enable

This bit is set and reset by software.

0: BKPSRAM clock disabled

1: BKPSRAM clock enabled

Bits 27:25 Reserved, must be kept at reset value.

Bit 24 GTZC1EN : GTZC1 clock enable

This bit is set and reset by software.

0: GTZC1 clock disabled

1: GTZC1 clock enabled

Bits 23:22 Reserved, must be kept at reset value.

Bit 21 DCACHE2EN : DCACHE2 clock enable

This bit is set and reset by software.

0: DCACHE2 clock disabled

1: DCACHE2 clock enabled

Note: DCACHE2 clock must be enabled to access memories, even if the DCACHE2 is bypassed.

This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 20 GPU2DEN : GPU2D clock enable

This bit is set and cleared by software.

0: GPU2D clock disabled

1: GPU2D clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 19 GFXMMUEN : GFXMMU clock enable

This bit is set and cleared by software.

0: GFXMMU clock disabled

1: GFXMMU clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 18 DMA2DEN : DMA2D clock enable

This bit is set and cleared by software.

0: DMA2D clock disabled

1: DMA2D clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 17 RAMCFGEN : RAMCFG clock enable

This bit is set and cleared by software.

0: RAMCFG clock disabled

1: RAMCFG clock enabled

Bit 16 TSCEN : Touch sensing controller clock enable

This bit is set and cleared by software.

0: TSC clock disabled

1: TSC clock enabled

Bit 15 JPEGEN : JPEG clock enable

This bit is set and cleared by software.

0: JPEG clock disabled

1: JPEG clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 14:13 Reserved, must be kept at reset value.

Bit 12 CRCEN : CRC clock enable

This bit is set and cleared by software.

0: CRC clock disabled

1: CRC clock enabled

Bits 11:9 Reserved, must be kept at reset value.

Bit 8 FLASHEN : FLASH clock enable

This bit is set and cleared by software. This bit can be disabled only when the flash memory is in power-down mode.

0: FLASH clock disabled

1: FLASH clock enabled

Bits 7:4 Reserved, must be kept at reset value.

Bit 3 MDF1EN : MDF1 clock enable

This bit is set and reset by software.

0: MDF1 clock disabled

1: MDF1 clock enabled

Bit 2 FMACEN : FMAC clock enable

This bit is set and reset by software.

0: FMAC clock disabled

1: FMAC clock enabled

Bit 1 CORDICEN : CORDIC clock enable

This bit is set and cleared by software.

0: CORDIC clock disabled

1: CORDIC clock enabled

Bit 0 GPDMA1EN : GPDMA1 clock enable

This bit is set and cleared by software.

0: GPDMA1 clock disabled

1: GPDMA1 clock enabled

11.8.30 RCC AHB2 peripheral clock enable register 1 (RCC_AHB2ENR1)

Address offset: 0x08C

Reset value: 0x4000 0000 (for STM32U535/545)

Reset value: 0xC000 0000 (for STM32U575/585/59x/5Ax/5Fx/5Gx)

Access: no wait state, word, half-word, and byte access

Note: When the peripheral clock is not active, read or write access to peripheral registers is not supported.

31302928272625242322212019181716
SRAM3 ENSRAM2 ENRes.SDMMC2 ENSDMMC1 ENRes.Res.OTFDE C2ENOTFDE C1ENRes.OCTOS PIMENSAESENPKAENRNGENHASHENAESEN
rwrwrwrwrwrwrwrwrwrwrwrw

1514131211109876543210
OTGH SPHYE NOTGE NRes.DCMI PSSIE NRes.ADC12 ENGPIOJ ENGPIOIE NGPIOH ENGPIOG ENGPIOF ENGPIOE ENGPIO D ENGPIO C ENGPIO B ENGPIO A EN
rwrwrwrwrwrwrwrwrwrwrwrwrwrw

Bit 31 SRAM3EN : SRAM3 clock enable

This bit is set and reset by software.

0: SRAM3 clock disabled

1: SRAM3 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 30 SRAM2EN : SRAM2 clock enable

This bit is set and reset by software.

0: SRAM2 clock disabled

1: SRAM2 clock enabled

Bit 29 Reserved, must be kept at reset value.

Bit 28 SDMMC2EN : SDMMC2 clock enable

This bit is set and cleared by software.

0: SDMMC2 clock disabled

1: SDMMC2 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 27 SDMMC1EN : SDMMC1 clock enable

This bit is set and cleared by software.

0: SDMMC1 clock disabled

1: SDMMC1 clock enabled

Bits 26:25 Reserved, must be kept at reset value.

Bit 24 OTFDEC2EN : OTFDEC2 clock enable

This bit is set and cleared by software.

0: OTFDEC2 clock disabled

1: OTFDEC2 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 23 OTFDEC1EN : OTFDEC1 clock enable

This bit is set and cleared by software.

0: OTFDEC1 clock disabled

1: OTFDEC1 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 22 Reserved, must be kept at reset value.

Bit 21 OCTOSPIMEN : OCTOSPIM clock enable

This bit is set and cleared by software.

0: OCTOSPIM clock disabled

1: OCTOSPIM clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 20 SAESEN : SAES clock enable

This bit is set and cleared by software.

0: SAES clock disabled

1: SAES clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 19 PKAEN : PKA clock enable

This bit is set and cleared by software.

0: PKA clock disabled

1: PKA clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 18 RNGEN : RNG clock enable

This bit is set and cleared by software.

0: RNG clock disabled

1: RNG clock enabled

Bit 17 HASHEN : HASH clock enable

This bit is set and cleared by software

0: HASH clock disabled

1: HASH clock enabled

Bit 16 AESEN : AES clock enable

This bit is set and cleared by software.

0: AES clock disabled

1: AES clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 15 OTGHSPHYEN : OTG_HS PHY clock enable

This bit is set and cleared by software.

0: OTG_HS PHY clock disabled

1: OTG_HS PHY clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 14 OTGEN : OTG_FS or OTG_HS clock enable

This bit is set and cleared by software.

0: OTG_FS or OTG_HS clock disabled

1: OTG_FS or OTG_HS clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 13 Reserved, must be kept at reset value.

Bit 12 DCMI_PSSIEN : DCMI and PSSI clock enable

This bit is set and cleared by software.

0: DCMI and PSSI clock disabled

1: DCMI and PSSI clock enabled

Bit 11 Reserved, must be kept at reset value.

Bit 10 ADC12EN : ADC1 and ADC2 clock enable

This bit is set and cleared by software.

0: ADC1 and ADC2 clock disabled

1: ADC1 and ADC2 clock enabled

Note: This bit impacts ADC1 in STM32U535/545/575/585, and ADC1/ADC2 in STM32U59x/5Ax/5Fx/5Gx.

Bit 9 GPIOJEN : I/O port J clock enable

This bit is set and cleared by software.

0: I/O port J clock disabled

1: I/O port J clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 8 GPIOIEN : I/O port I clock enable

This bit is set and cleared by software.

0: I/O port I clock disabled

1: I/O port I clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 7 GPIOHEN : I/O port H clock enable

This bit is set and cleared by software.

0: I/O port H clock disabled

1: I/O port H clock enabled

Bit 6 GPIOGEN : I/O port G clock enable

This bit is set and cleared by software.

0: I/O port G clock disabled

1: I/O port G clock enabled

Bit 5 GPIOFEN : I/O port F clock enable

This bit is set and cleared by software.

0: I/O port F clock disabled

1: I/O port F clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 4 GPIOEEN : I/O port E clock enable

This bit is set and cleared by software.

0: I/O port E clock disabled

1: I/O port E clock enabled

Bit 3 GPIO DEN : I/O port D clock enable

This bit is set and cleared by software.

0: I/O port D clock disabled

1: I/O port D clock enabled

Bit 2 GPIOCEN : I/O port C clock enable

This bit is set and cleared by software.

0: I/O port C clock disabled

1: I/O port C clock enabled

Bit 1 GPIOBEN : I/O port B clock enable

This bit is set and cleared by software.

0: I/O port B clock disabled

1: I/O port B clock enabled

Bit 0 GPIOAEN : I/O port A clock enable

This bit is set and cleared by software.

0: I/O port A clock disabled

1: I/O port A clock enabled

11.8.31 RCC AHB2 peripheral clock enable register 2 (RCC_AHB2ENR2)

Address offset: 0x090

Reset value: 0x0000 0000 (for STM32U535/545/575/585)

Reset value: 0x8000 0000 (for STM32U59x/5Ax)

Reset value: 0xC000 0000 (for STM32U5Fx/5Gx)

Access: no wait state; word, half-word, and byte access

Note: When the peripheral clock is not active, read or write access to peripheral registers is not supported.

31302928272625242322212019181716
SRAM5 ENSRAM6 ENRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
rwrw
1514131211109876543210
Res.Res.Res.HSPI1 ENRes.Res.Res.OCTOS PI2ENRes.Res.Res.OCTOS PI1ENRes.Res.Res.FSMCEN
rwrwrwrw

Bit 31 SRAM5EN : SRAM5 clock enable

This bit is set and reset by software.

0: SRAM5 clock disabled

1: SRAM5 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 30 SRAM6EN : SRAM6 clock enable

This bit is set and reset by software.

0: SRAM6 clock disabled

1: SRAM6 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 29:13 Reserved, must be kept at reset value.

Bit 12 HSPI1EN : HSPI1 clock enable

This bit is set and cleared by software.

0: HSPI1 clock disabled

1: HSPI1 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 11:9 Reserved, must be kept at reset value.

Bit 8 OCTOSPI2EN : OCTOSPI2 clock enable

This bit is set and cleared by software.

0: OCTOSPI2 clock disabled

1: OCTOSPI2 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 7:5 Reserved, must be kept at reset value.

Bit 4 OCTOSPI1EN : OCTOSPI1 clock enable

This bit is set and cleared by software.

0: OCTOSPI1 clock disabled

1: OCTOSPI1 clock enabled

Bits 3:1 Reserved, must be kept at reset value.

Bit 0 FSMCEN : FSMC clock enable

This bit is set and cleared by software.

0: FSMC clock disabled

1: FSMC clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

11.8.32 RCC AHB3 peripheral clock enable register (RCC_AHB3ENR)

Address offset: 0x094

Reset value: 0x8000 0000

Access: no wait state; word, half-word, and byte access

Note: When the peripheral clock is not active, read or write access to peripheral registers is not supported.

31302928272625242322212019181716
SRAM4ENRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
rw
1514131211109876543210
Res.Res.Res.GTZC2ENRes.ADF1ENLPDMA1ENRes.Res.DAC1ENADC4ENRes.Res.PWRENRes.LPGPIO1EN
rwrwrwrwrwrwrw

Bit 31 SRAM4EN : SRAM4 clock enable

This bit is set and reset by software.

0: SRAM4 clock disabled

1: SRAM4 clock enabled

Bits 30:13 Reserved, must be kept at reset value.

Bit 12 GTZC2EN : GTZC2 clock enable

This bit is set and cleared by software.

0: GTZC2 clock disabled

1: GTZC2 clock enabled

11.8.33 RCC APB1 peripheral clock enable register 1 (RCC_APB1ENR1)

Address offset: 0x09C

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

Note: When the peripheral clock is not active, read or write access to peripheral registers is not supported.

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.USART6ENCRSENGRes.I2C2ENI2C1ENUART5ENUART4ENUSART3ENUSART2ENRes.
rwrwrwrwrwrwrwrw
1514131211109876543210
Res.SPI2ENRes.Res.WWDGENRes.Res.Res.Res.Res.TIM7ENTIM6ENTIM5ENTIM4ENTIM3ENTIM2EN
rwrsrwrwrwrwrwrw

Bits 31:26 Reserved, must be kept at reset value.

Bit 25 USART6EN : USART6 clock enable

This bit is set and cleared by software.

0: USART6 clock disabled

1: USART6 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 24 CRSEN : CRS clock enable

This bit is set and cleared by software.

0: CRS clock disabled

1: CRS clock enabled

Bit 23 Reserved, must be kept at reset value.

Bit 22 I2C2EN : I2C2 clock enable

This bit is set and cleared by software.

0: I2C2 clock disabled

1: I2C2 clock enabled

Bit 21 I2C1EN : I2C1 clock enable

This bit is set and cleared by software.

0: I2C1 clock disabled

1: I2C1 clock enabled

Bit 20 UART5EN : UART5 clock enable

This bit is set and cleared by software.

0: UART5 clock disabled

1: UART5 clock enabled

Bit 19 UART4EN : UART4 clock enable

This bit is set and cleared by software.

0: UART4 clock disabled

1: UART4 clock enabled

Bit 18 USART3EN : USART3 clock enable

This bit is set and cleared by software.

0: USART3 clock disabled

1: USART3 clock enabled

Bit 17 USART2EN : USART2 clock enable

This bit is set and cleared by software.

0: USART2 clock disabled

1: USART2 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 16:15 Reserved, must be kept at reset value.

Bit 14 SPI2EN : SPI2 clock enable

This bit is set and cleared by software.

0: SPI2 clock disabled

1: SPI2 clock enabled

Bits 13:12 Reserved, must be kept at reset value.

Bit 11 WWDGREN : WWDG clock enable

This bit is set by software to enable the window watchdog clock. It is reset by hardware system reset. This bit can also be set by hardware if the WWDG_SW option bit is reset.

0: WWDG clock disabled

1: WWDG clock enabled

Bits 10:6 Reserved, must be kept at reset value.

Bit 5 TIM7EN : TIM7 clock enable

This bit is set and cleared by software.

0: TIM7 clock disabled

1: TIM7 clock enabled

Bit 4 TIM6EN : TIM6 clock enable

This bit is set and cleared by software.

0: TIM6 clock disabled

1: TIM6 clock enabled

Bit 3 TIM5EN : TIM5 clock enable

This bit is set and cleared by software.

0: TIM5 clock disabled

1: TIM5 clock enabled

Bit 2 TIM4EN : TIM4 clock enable

This bit is set and cleared by software.

0: TIM4 clock disabled

1: TIM4 clock enabled

Bit 1 TIM3EN : TIM3 clock enable

This bit is set and cleared by software.

0: TIM3 clock disabled

1: TIM3 clock enabled

Bit 0 TIM2EN : TIM2 clock enable

This bit is set and cleared by software.

0: TIM2 clock disabled

1: TIM2 clock enabled

11.8.34 RCC APB1 peripheral clock enable register 2 (RCC_APB1ENR2)

Address offset: 0x0A0

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

Note: When the peripheral clock is not active, read or write access to peripheral registers is not supported.

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.UCPD1ENRes.Res.Res.Res.Res.Res.Res.
rw
1514131211109876543210
Res.Res.Res.Res.Res.Res.FDCAN1ENRes.I2C6ENI2C5ENLPTIM2ENRes.Res.Res.I2C4ENRes.
rwrwrwrwrw

Bits 31:24 Reserved, must be kept at reset value.

Bit 23 UCPD1EN : UCPD1 clock enable

This bit is set and cleared by software.

0: UCPD1 clock disabled

1: UCPD1 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 22:10 Reserved, must be kept at reset value.

Bit 9 FDCAN1EN : FDCAN1 clock enable

This bit is set and cleared by software.

0: FDCAN1 clock disabled

1: FDCAN1 clock enabled

Note: This bit is only available on some devices in the STM32U5 series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and kept at reset value.

Bit 8 Reserved, must be kept at reset value.

Bit 7 I2C6EN : I2C6 clock enable

This bit is set and cleared by software.

0: I2C6 clock disabled

1: I2C6 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 6 I2C5EN : I2C5 clock enable

This bit is set and cleared by software.

0: I2C5 clock disabled

1: I2C5 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 5 LPTIM2EN : LPTIM2 clock enable

This bit is set and cleared by software.

0: LPTIM2 clock disabled

1: LPTIM2 clock enabled

Bits 4:2 Reserved, must be kept at reset value.

Bit 1 I2C4EN : I2C4 clock enable

This bit is set and cleared by software

0: I2C4 clock disabled

1: I2C4 clock enabled

Bit 0 Reserved, must be kept at reset value.

11.8.35 RCC APB2 peripheral clock enable register (RCC_APB2ENR)

Address offset: 0x0A4

Reset value: 0x0000 0000

Access: word, half-word, and byte access

Note: When the peripheral clock is not active, read or write access to peripheral registers is not supported.

31302928272625242322212019181716
Res.Res.Res.Res.DSIENLTDCE
N
GFXTI
MEN
USBENRes.SAI2E
N
SAI1E
N
Res.Res.TIM17E
N
TIM16E
N
TIM15E
N
rwrwrwrwrwrwrwrwrw

1514131211109876543210
Res.USART
1EN
TIM8E
N
SPI1E
N
TIM1E
N
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
rwrwrwrw

Bits 31:28 Reserved, must be kept at reset value.

Bit 27 DSIEN : DSI clock enable

This bit is set and cleared by software.

0: DSI clock disabled

1: DSI clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 26 LTDCEEN : LTDC clock enable

This bit is set and cleared by software.

0: LTDC clock disabled

1: LTDC clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 25 GFXTIMEN : GFXTIM clock enable

This bit is set and cleared by software.

0: GFXTIM clock disabled

1: GFXTIM clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 24 USBEN : USB clock enable

This bit is set and cleared by software.

0: USB clock disabled

1: USB clock enabled

Note: This bit is only available on STM32U535/545 devices, it is reserved on other devices in the STM32U5 Series. If not present, consider this bit as reserved and keep it at reset value.

Bit 23 Reserved, must be kept at reset value.

Bit 22 SAI2EN : SAI2 clock enable

This bit is set and cleared by software.

0: SAI2 clock disabled

1: SAI2 clock enabled

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral.

Bit 21 SAI1EN : SAI1 clock enable

This bit is set and cleared by software.

0: SAI1 clock disabled

1: SAI1 clock enabled

Bits 20:19 Reserved, must be kept at reset value.

Bit 18 TIM17EN : TIM17 clock enable

This bit is set and cleared by software.

0: TIM17 clock disabled

1: TIM17 clock enabled

Bit 17 TIM16EN : TIM16 clock enable

This bit is set and cleared by software.

0: TIM16 clock disabled

1: TIM16 clock enabled

Bit 16 TIM15EN : TIM15 clock enable

This bit is set and cleared by software.

0: TIM15 clock disabled

1: TIM15 clock enabled

Bit 15 Reserved, must be kept at reset value.

Bit 14 USART1EN : USART1 clock enable

This bit is set and cleared by software.

0: USART1 clock disabled

1: USART1 clock enabled

Bit 13 TIM8EN : TIM8 clock enable

This bit is set and cleared by software.

0: TIM8 clock disabled

1: TIM8 clock enabled

Bit 12 SPI1EN : SPI1 clock enable

This bit is set and cleared by software.

0: SPI1 clock disabled

1: SPI1 clock enabled

Bit 11 TIM1EN : TIM1 clock enable

This bit is set and cleared by software.

0: TIM1 clock disabled

1: TIM1 clock enabled

Bits 10:0 Reserved, must be kept at reset value.

11.8.36 RCC APB3 peripheral clock enable register (RCC_APB3ENR)

Address offset: 0x0A8

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.RTCAPBENVREFENRes.Res.Res.Res.
rwrw
1514131211109876543210
COMPENOPAMPENLPTIM4ENLPTIM3ENLPTIM1ENRes.Res.Res.I2C3ENLPUART1ENSPI3ENRes.Res.Res.SYSCFGENRes.
rwrwrwrwrwrwrwrwrw

Bits 31:22 Reserved, must be kept at reset value.

Bit 21 RTCAPBEN : RTC and TAMP APB clock enable

This bit is set and cleared by software.

0: RTC and TAMP APB clock disabled

1: RTC and TAMP APB clock enabled

Bit 20 VREFEN : VREFBUF clock enable

This bit is set and cleared by software.

0: VREFBUF clock disabled

1: VREFBUF clock enabled

Bits 19:16 Reserved, must be kept at reset value.

Bit 15 COMPEN : COMP clock enable

This bit is set and cleared by software.

0: COMP clock disabled

1: COMP clock enabled

Bit 14 OPAMPEN : OPAMP clock enable

This bit is set and cleared by software.

0: OPAMP clock disabled

1: OPAMP clock enabled

Bit 13 LPTIM4EN : LPTIM4 clock enable

This bit is set and cleared by software.

0: LPTIM4 clock disabled

1: LPTIM4 clock enabled

Bit 12 LPTIM3EN : LPTIM3 clock enable

This bit is set and cleared by software.

0: LPTIM3 clock disabled

1: LPTIM3 clock enabled

Bit 11 LPTIM1EN : LPTIM1 clock enable

This bit is set and cleared by software.

0: LPTIM1 clock disabled

1: LPTIM1 clock enabled

Bits 10:8 Reserved, must be kept at reset value.

Bit 7 I2C3EN : I2C3 clock enable

This bit is set and cleared by software.

0: I2C3 clock disabled

1: I2C3 clock enabled

Bit 6 LPUART1EN : LPUART1 clock enable

This bit is set and cleared by software.

0: LPUART1 clock disabled

1: LPUART1 clock enabled

Bit 5 SPI3EN : SPI3 clock enable

This bit is set and cleared by software.

0: SPI3 clock disabled

1: SPI3 clock enabled

Bits 4:2 Reserved, must be kept at reset value.

Bit 1 SYSCFGEN : SYSCFG clock enable

This bit is set and cleared by software.

0: SYSCFG clock disabled

1: SYSCFG clock enabled

Bit 0 Reserved, must be kept at reset value.

11.8.37 RCC AHB1 peripheral clock enable in Sleep and Stop modes register (RCC_AHB1SMENR)

Address offset: 0x0B0

Reset value: 0xFFFF FFFF

Access: no wait state, word, half-word, and byte access

This register only configures the clock gating, not the clock source itself. When a bit is set in Stop mode, the corresponding peripheral clock is enabled only when a peripheral (this one or another) requests the AHB or APB clock (refer to Section 11.4.24 ).

31302928272625242322212019181716
SRAM1
SMEN
DCAC
HE1SM
EN
ICACH
ESME
N
BKPSR
AMSM
EN
Res.Res.Res.GTZC1
SMEN
Res.Res.DCAC
HE2SM
EN
GPU2D
SMEN
GFXM
MUSM
EN
DMA2D
SMEN
RAMC
FGSM
EN
TSCSM
EN
rwrwrwrwrwrwrwrwrwrwrw
1514131211109876543210
JPEGSMENRes.Res.CRCS
MEN
Res.Res.Res.FLASH
SMEN
Res.Res.Res.Res.MDF1SMENFMACS
MEN
CORDI
CSME
N
GPDM
A1SME
N
rwrwrwrwrwrwrw

Bit 31 SRAM1SMEN : SRAM1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SRAM1 clocks disabled by the clock gating during Sleep and Stop modes

1: SRAM1 clocks enabled by the clock gating during Sleep and Stop modes

Bit 30 DCACHE1SMEN : DCACHE1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: DCACHE1 clocks disabled by the clock gating during Sleep and Stop modes

1: DCACHE1 clocks enabled by the clock gating during Sleep and Stop modes

Bit 29 ICACHESMEN : ICACHE clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: ICACHE clocks disabled by the clock gating during Sleep and Stop modes

1: ICACHE clocks enabled by the clock gating during Sleep and Stop modes

Bit 28 BKPSRAMSMEN : BKPSRAM clock enable during Sleep and Stop modes

This bit is set and cleared by software

0: BKPSRAM clocks disabled by the clock gating during Sleep and Stop modes

1: BKPSRAM clocks enabled by the clock gating during Sleep and Stop modes

Bits 27:25 Reserved, must be kept at reset value.

Bit 24 GTZC1SMEN : GTZC1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: GTZC1 clocks disabled by the clock gating during Sleep and Stop modes

1: GTZC1 clocks enabled by the clock gating during Sleep and Stop modes

Bits 23:22 Reserved, must be kept at reset value.

Bit 21 DCACHE2SMEN : DCACHE2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: DCACHE2 clocks disabled by the clock gating during Sleep and Stop modes

1: DCACHE2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 20 GPU2DSMEN : GPU2D clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: GPU2D clocks disabled by the clock gating during Sleep and Stop modes

1: GPU2D clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 19 GFXMMUSMEN : GFXMMU clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: GFXMMU clocks disabled by the clock gating during Sleep and Stop modes

1: GFXMMU clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 18 DMA2DSMEN : DMA2D clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: DMA2D clocks disabled by the clock gating during Sleep and Stop modes

1: DMA2D clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 17 RAMCFGSMEN : RAMCFG clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: RAMCFG clocks disabled by the clock gating during Sleep and Stop modes

1: RAMCFG clocks enabled by the clock gating during Sleep and Stop modes

Bit 16 TSCSMEN : TSC clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TSC clocks disabled by the clock gating during Sleep and Stop modes

1: TSC clocks enabled by the clock gating during Sleep and Stop modes

Bit 15 JPEGSMEN : JPEG clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: JPEG clocks disabled by the clock gating during Sleep and Stop modes

1: JPEG clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 14:13 Reserved, must be kept at reset value.

Bit 12 CRCSMEN : CRC clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: CRC clocks disabled by the clock gating during Sleep and Stop modes

1: CRC clocks enabled by the clock gating during Sleep and Stop modes

Bits 11:9 Reserved, must be kept at reset value.

Bit 8 FLASHSMEN : FLASH clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: FLASH clocks disabled by the clock gating during Sleep and Stop modes

1: FLASH clocks enabled by the clock gating during Sleep and Stop modes

Bits 7:4 Reserved, must be kept at reset value.

Bit 3 MDF1SMEN : MDF1 clocks enable during Sleep and Stop modes.

This bit is set and cleared by software.

0: MDF1 clocks disabled by the clock gating during Sleep and Stop modes

1: MDF1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 2 FMACSMEN : FMAC clocks enable during Sleep and Stop modes.

This bit is set and cleared by software.

0: FMAC clocks disabled by the clock gating during Sleep and Stop modes

1: FMAC clocks enabled by the clock gating during Sleep and Stop modes

Bit 1 CORDICSMEN : CORDIC clocks enable during Sleep and Stop modes

This bit is set and cleared by software during Sleep mode.

0: CORDIC clocks disabled by the clock gating during Sleep and Stop modes

1: CORDIC clocks enabled by the clock gating during Sleep and Stop modes

Bit 0 GPDMA1SMEN : GPDMA1 clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: GPDMA1 clocks disabled by the clock gating during Sleep and Stop modes

1: GPDMA1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

11.8.38 RCC AHB2 peripheral clock enable in Sleep and Stop modes register 1 (RCC_AHB2SMENR1)

Address offset: 0x0B4

Reset value: 0xFFFF FFFF

Access: no wait state; word, half-word, and byte access

This register only configures the clock gating, not the clock source itself. When a bit is set in Stop mode, the corresponding peripheral clock is enabled only when a peripheral (this one or another) requests the AHB or APB clock (refer to Section 11.4.24 ).

31302928272625242322212019181716
SRAM3 SMENSRAM2 SMENRes.SDMMC2 SMENSDMMC1 SMENRes.Res.OTFDE C2SMENOTFDE C1SMENRes.OCTOS PIMSM ENSAESS MENPKASM ENRNGS MENHASHS MENAESSM EN
rwrwrwrwrwrwrwrwrwrwrwrw

1514131211109876543210
OTGH SPHYS MENOTGS MENRes.DCMI_PSSIS MENRes.ADC12 SMENGPIOJ SMENGPIOIS MENGPIOH SMENGPIOG SMENGPIOF SMENGPIOE SMENGPIO D SMENGPIOC SMENGPIOB SMENGPIOA SMEN
rwrwrwrwrwrwrwrwrwrwrwrwrwrw

Bit 31 SRAM3SMEN : SRAM3 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SRAM3 clocks disabled by the clock gating during Sleep and Stop modes

1: SRAM3 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 30 SRAM2SMEN : SRAM2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SRAM2 clocks disabled by the clock gating during Sleep and Stop modes

1: SRAM2 clocks enabled by the clock gating during Sleep and Stop modes

Bit 29 Reserved, must be kept at reset value.

Bit 28 SDMMC2SMEN : SDMMC2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SDMMC2 clocks disabled by the clock gating during Sleep and Stop modes

1: SDMMC2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 27 SDMMC1SMEN : SDMMC1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SDMMC1 clocks disabled by the clock gating during Sleep and Stop modes

1: SDMMC1 clocks enabled by the clock gating during Sleep and Stop modes

Bits 26:25 Reserved, must be kept at reset value.

Bit 24 OTFDEC2SMEN : OTFDEC2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: OTFDEC2 clocks disabled by the clock gating during Sleep and Stop modes

1: OTFDEC2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 23 OTFDEC1SMEN : OTFDEC1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: OTFDEC1 clocks disabled by the clock gating during Sleep and Stop modes

1: OTFDEC1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 22 Reserved, must be kept at reset value.

Bit 21 OCTOSPIMSMEN : OCTOSPIM clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: OCTOSPIM clocks disabled by the clock gating during Sleep and Stop modes

1: OCTOSPIM clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 20 SAESSMEN : SAES accelerator clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SAES clocks disabled by the clock gating during Sleep and Stop modes

1: SAES clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 19 PKASMEN : PKA clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: PKA clocks disabled by the clock gating during Sleep and Stop modes

1: PKA clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 18 RNGSMEN : RNG clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: RNG clocks disabled by the clock gating during Sleep and Stop modes

1: RNG clocks enabled by the clock gating during Sleep and Stop modes

Bit 17 HASHSMEN : HASH clock enable during Sleep and Stop modes

This bit is set and cleared by software

0: HASH clocks disabled by the clock gating during Sleep and Stop modes

1: HASH clocks enabled by the clock gating during Sleep and Stop modes

Bit 16 AESSMEN: AES clock enable during Sleep and Stop modes

This bit is set and cleared by software

0: AES clocks disabled by the clock gating during Sleep and Stop modes

1: AES clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 15 OTGHSPHYSMEN: OTG_HS PHY clock enable during Sleep and Stop modes

This bit is set and cleared by software

0: OTG_HS PHY clocks disabled by the clock gating during Sleep and Stop modes

1: OTG_HS PHY clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 14 OTGSMEN: OTG_FS and OTG_HS clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: OTG_FS and OTG_HS clocks disabled by the clock gating during Sleep and Stop modes

1: OTG_FS and OTG_HS clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 13 Reserved, must be kept at reset value.

Bit 12 DCMI_PSSISMEN: DCMI and PSSI clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: DCMI and PSSI clocks disabled by the clock gating during Sleep and Stop modes

1: DCMI and PSSI clocks enabled by the clock gating during Sleep and Stop modes

Bit 11 Reserved, must be kept at reset value.

Bit 10 ADC12SMEN: ADC1 and ADC2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: ADC1 and ADC2 clocks disabled by the clock gating during Sleep and Stop modes

1: ADC1 and ADC2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit impacts ADC1 in STM32U535/545/575/585 and ADC1/ADC2 in STM32U59x/5Ax/5Fx/5Gx.

Bit 9 GPIOJSMEN: I/O port J clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port J clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port J clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 8 GPIOISMEN: I/O port I clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port I clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port I clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 7 GPIOHSMEN : I/O port H clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port H clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port H clocks enabled by the clock gating during Sleep and Stop modes

Bit 6 GPIOGSMEN : I/O port G clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port G clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port G clocks enabled by the clock gating during Sleep and Stop modes

Bit 5 GPIOFSMEN : I/O port F clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port F clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port F clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 4 GPIUESMEN : I/O port E clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port E clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port E clocks enabled by the clock gating during Sleep and Stop modes

Bit 3 GPIODSMEN : I/O port D clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port D clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port D clocks enabled by the clock gating during Sleep and Stop modes

Bit 2 GPIOCSMEN : I/O port C clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port C clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port C clocks enabled by the clock gating during Sleep and Stop modes

Bit 1 GPIOBSMEN : I/O port B clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port B clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port B clocks enabled by the clock gating during Sleep and Stop modes

Bit 0 GPIOSMEN : I/O port A clocks enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I/O port A clocks disabled by the clock gating during Sleep and Stop modes

1: I/O port A clocks enabled by the clock gating during Sleep and Stop modes

11.8.39 RCC AHB2 peripheral clock enable in Sleep and Stop modes register 2 (RCC_AHB2SMENR2)

Address offset: 0x0B8

Reset value: 0xFFFF FFFF

Access: no wait state; word, half-word and byte access

This register only configures the clock gating, not the clock source itself.

When a bit is set in Stop mode, the corresponding peripheral clock is enabled only when a peripheral (this one or another) requests AHB or APB clock (refer to Section 11.4.24 ).

31302928272625242322212019181716
SRAM5 SMENSRAM6 SMENRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.HSPI1 SMENRes.Res.Res.OCTOS PI2SM ENRes.Res.Res.OCTOS PI1SM ENRes.Res.Res.FSMCS MEN
rwrwrwrw

Bit 31 SRAM5SMEN : SRAM5 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SRAM5 clocks disabled by the clock gating during Sleep and Stop modes

1: SRAM5 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 30 SRAM6SMEN : SRAM6 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SRAM6 clocks disabled by the clock gating during Sleep and Stop modes

1: SRAM6 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 29:13 Reserved, must be kept at reset value.

Bit 12 HSPI1SMEN : HSPI1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: HSPI1 clocks disabled by the clock gating during Sleep and Stop modes

1: HSPI1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 11:9 Reserved, must be kept at reset value.

Bit 8 OCTOSPI2SMEN : OCTOSPI2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: OCTOSPI2 clocks disabled by the clock gating during Sleep and Stop modes

1: OCTOSPI2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 7:5 Reserved, must be kept at reset value.

Bit 4 OCTOSPI1SMEN : OCTOSPI1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: OCTOSPI1 clocks disabled by the clock gating during Sleep and Stop modes

1: OCTOSPI1 clocks enabled by the clock gating during Sleep and Stop modes

Bits 3:1 Reserved, must be kept at reset value.

Bit 0 FSMCSMEN : FSMC clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: FSMC clocks disabled by the clock gating during Sleep and Stop modes

1: FSMC clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

11.8.40 RCC AHB3 peripheral clock enable in Sleep and Stop modes register (RCC_AHB3SMENR)

Address offset: 0x0BC

Reset value: 0xFFFF FFFF

Access: no wait state; word, half-word, and byte access

This register only configures the clock gating, not the clock source itself. When a bit is set in Stop mode, the corresponding peripheral clock is enabled only when a peripheral (this one or another) requests the AHB or APB clock (refer to Section 11.4.24 ).

31302928272625242322212019181716
SRAM4
SMEN
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
rw
1514131211109876543210
Res.Res.Res.GTZC2
SMEN
Res.ADF1S
MEN
LPDMA
1SMEN
Res.Res.DAC1S
MEN
ADC4S
MEN
Res.Res.PWRS
MEN
Res.LP GPI
O1SME
N
rwrwrwrwrwrwrw

Bit 31 SRAM4SMEN : SRAM4 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SRAM4 clocks disabled by the clock gating during Sleep and Stop modes

1: SRAM4 clocks enabled by the clock gating during Sleep and Stop modes

Bits 30:13 Reserved, must be kept at reset value.

Bit 12 GTZC2SMEN : GTZC2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: GTZC2 clock disabled by the clock gating during Sleep and Stop modes

1: GTZC2 clock enabled by the clock gating during Sleep and Stop modes

Bit 11 Reserved, must be kept at reset value.

Bit 10 ADF1SMEN : ADF1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: ADF1 clock disabled by the clock gating during Sleep and Stop modes

1: ADF1 clock enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 9 LPDMA1SMEN : LPDMA1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: LPDMA1 clock disabled by the clock gating during Sleep and Stop modes

1: LPDMA1 clock enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bits 8:7 Reserved, must be kept at reset value.

Bit 6 DAC1SMEN : DAC1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: DAC1 clock disabled by the clock gating during Sleep and Stop modes

1: DAC1 clock enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 5 ADC4SMEN : ADC4 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: ADC4 clock disabled by the clock gating during Sleep and Stop modes

1: ADC4 clock enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bits 4:3 Reserved, must be kept at reset value.

Bit 2 PWRSMEN : PWR clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: PWR clock disabled by the clock gating during Sleep and Stop modes

1: PWR clock enabled by the clock gating during Sleep and Stop modes

Bit 1 Reserved, must be kept at reset value.

Bit 0 LPGPIO1SMEN : LPGPIO1 enable during Sleep and Stop modes

This bit is set and cleared by software.

0: LPGPIO1 clock disabled by the clock gating during Sleep and Stop modes

1: LPGPIO1 clock enabled by the clock gating during Sleep and Stop modes

11.8.41 RCC APB1 peripheral clock enable in Sleep and Stop modes register 1 (RCC_APB1SMENR1)

Address offset: 0x0C4

Reset value: 0xFFFF FFFF

Access: no wait state; word, half-word, and byte access

This register only configures the clock gating, not the clock source itself. When a bit is set in Stop mode, the corresponding peripheral clock is enabled only when a peripheral (this one or another) requests the AHB or APB clock (refer to Section 11.4.24 ).

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.USART6SMENCRSSMENRes.I2C2SMENI2C1SMENUART5SMENUART4SMENUSART3SMENUSART2SMENRes.
rwrwrwrwrwrwrwrw

1514131211109876543210
Res.SPI2SMENRes.Res.WWDGSMENRes.Res.Res.Res.Res.TIM7SMENTIM6SMENTIM5SMENTIM4SMENTIM3SMENTIM2SMEN
rwrwrwrwrwrwrwrw

Bits 31:26 Reserved, must be kept at reset value.

Bit 25 USART6SMEN : USART6 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: USART6 clocks disabled by the clock gating during Sleep and Stop modes

1: USART6 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 24 CRSSMEN : CRS clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: CRS clocks disabled by the clock gating during Sleep and Stop modes

1: CRS clocks enabled by the clock gating during Sleep and Stop modes

Bit 23 Reserved, must be kept at reset value.

Bit 22 I2C2SMEN : I2C2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I2C2 clocks disabled by the clock gating during Sleep and Stop modes

1: I2C2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 21 I2C1SMEN : I2C1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I2C1 clocks disabled by the clock gating during Sleep and Stop modes

1: I2C1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 20 UART5SMEN : UART5 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: UART5 clocks disabled by the clock gating during Sleep and Stop modes

1: UART5 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 19 UART4SMEN : UART4 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: UART4 clocks disabled by the clock gating during Sleep and Stop modes

1: UART4 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 18 USART3SMEN : USART3 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: USART3 clocks disabled by the clock gating during Sleep and Stop modes

1: USART3 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 17 USART2SMEN : USART2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: USART2 clocks disabled by the clock gating during Sleep and Stop modes

1: USART2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 16:15 Reserved, must be kept at reset value.

Bit 14 SPI2SMEN : SPI2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SPI2 clocks disabled by the clock gating during Sleep and Stop modes

1: SPI2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bits 13:12 Reserved, must be kept at reset value.

Bit 11 WWDGSMEN : Window watchdog clock enable during Sleep and Stop modes

This bit is set and cleared by software. It is forced to one by hardware when the hardware WWDG option is activated.

0: Window watchdog clocks disabled by the clock gating during Sleep and Stop modes

1: Window watchdog clocks enabled by the clock gating during Sleep and Stop modes

Bits 10:6 Reserved, must be kept at reset value.

Bit 5 TIM7SMEN : TIM7 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM7 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM7 clocks enabled by the clock gating during Sleep and Stop modes

Bit 4 TIM6SMEN : TIM6 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM6 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM6 clocks enabled by the clock gating during Sleep and Stop modes

Bit 3 TIM5SMEN : TIM5 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM5 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM5 clocks enabled by the clock gating during Sleep and Stop modes

Bit 2 TIM4SMEN : TIM4 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM4 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM4 clocks enabled by the clock gating during Sleep and Stop modes

Bit 1 TIM3SMEN : TIM3 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM3 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM3 clocks enabled by the clock gating during Sleep and Stop modes

Bit 0 TIM2SMEN : TIM2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM2 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM2 clocks enabled by the clock gating during Sleep and Stop modes

11.8.42 RCC APB1 peripheral clocks enable in Sleep and Stop modes register 2 (RCC_APB1SMENR2)

Address offset: 0x0C8

Reset value: 0xFFFF FFFF

Access: no wait state; word, half-word, and byte access

This register only configures the clock gating, not the clock source itself. When a bit is set in Stop mode, the corresponding peripheral clock is enabled only when a peripheral (this one or another) requests the AHB or APB clock (refer to Section 11.4.24 ).

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.UCPD1
SMEN
Res.Res.Res.Res.Res.Res.Res.
rw
1514131211109876543210
Res.Res.Res.Res.Res.Res.FDCAN
1SMEN
Res.I2C6S
MEN
I2C5S
MEN
LPTIM2
SMEN
Res.Res.Res.I2C4S
MEN
Res.
rwrwrwrwrw

Bits 31:24 Reserved, must be kept at reset value.

Bit 23 UCPD1SMEN : UCPD1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: UCPD1 clocks disabled by the clock gating during Sleep and Stop modes

1: UCPD1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 22:10 Reserved, must be kept at reset value.

Bit 9 FDCAN1SMEN : FDCAN1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: FDCAN1 clocks disabled by the clock gating during Sleep and Stop modes

1: FDCAN1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and kept at reset value.

Bit 8 Reserved, must be kept at reset value.

Bit 7 I2C6SMEN : I2C6 clock enable during Sleep and Stop modes

This bit is set and cleared by software

0: I2C6 clocks disabled by the clock gating during Sleep and Stop modes

1: I2C6 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 6 I2C5SMEN : I2C5 clock enable during Sleep and Stop modes

This bit is set and cleared by software

0: I2C5 clocks disabled by the clock gating during Sleep and Stop modes

1: I2C5 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 5 LPTIM2SMEN : LPTIM2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: LPTIM2 clocks disabled by the clock gating during Sleep and Stop modes

1: LPTIM2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bits 4:2 Reserved, must be kept at reset value.

Bit 1 I2C4SMEN : I2C4 clock enable during Sleep and Stop modes

This bit is set and cleared by software

0: I2C4 clocks disabled by the clock gating during Sleep and Stop modes

1: I2C4 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 0 Reserved, must be kept at reset value.

11.8.43 RCC APB2 peripheral clocks enable in Sleep and Stop modes register (RCC_APB2SMENR)

Address offset: 0x0CC

Reset value: 0xFFFF FFFF

Access: word, half-word, and byte access

This register only configures the clock gating, not the clock source itself. When a bit is set in Stop mode, the corresponding peripheral clock is enabled only when a peripheral (this one or another) requests the AHB or APB clock (refer to Section 11.4.24 ).

31302928272625242322212019181716
Res.Res.Res.Res.DSISMENLTDCSMENGFXTIMSMENUSBSMENRes.SAI2SMENSAI1SMENRes.Res.TIM17SMENTIM16SMENTIM15SMEN
rwrwrwrwrwrwrwrwrw
1514131211109876543210
Res.USART1SMENTIM8SMENSPI1SMENTIM1SMENRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
rwrwrwrw

Bits 31:28 Reserved, must be kept at reset value.

Bit 27 DSISMEN : DSI clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: DSI clocks disabled by the clock gating during Sleep and Stop modes

1: DSI clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 26 LTDCSMEN : LTDC clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: LTDC clocks disabled by the clock gating during Sleep and Stop modes

1: LTDC clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 25 GFXTIMSMEN : GFXTIM clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: GFXTIM clocks disabled by the clock gating during Sleep and Stop modes

1: GFXTIM clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 24 USBSMEN : USB clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: USB clocks disabled by the clock gating during Sleep and Stop modes

1: USB clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on STM32U535/545 devices, it is reserved on other devices in the STM32U5 Series. If not present, consider this bit as reserved and keep it at reset value.

Bit 23 Reserved, must be kept at reset value.

Bit 22 SAI2SMEN : SAI2 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SAI2 clocks disabled by the clock gating during Sleep and Stop modes

1: SAI2 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bit 21 SAI1SMEN : SAI1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SAI1 clocks disabled by the clock gating during Sleep and Stop modes

1: SAI1 clocks enabled by the clock gating during Sleep and Stop modes

Bits 20:19 Reserved, must be kept at reset value.

Bit 18 TIM17SMEN : TIM17 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM17 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM17 clocks enabled by the clock gating during Sleep and Stop modes

Bit 17 TIM16SMEN : TIM16 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM16 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM16 clocks enabled by the clock gating during Sleep and Stop modes

Bit 16 TIM15SMEN : TIM15 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM15 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM15 clocks enabled by the clock gating during Sleep and Stop modes

Bit 15 Reserved, must be kept at reset value.

Bit 14 USART1SMEN : USART1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: USART1 clocks disabled by the clock gating during Sleep and Stop modes

1: USART1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 13 TIM8SMEN : TIM8 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM8 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM8 clocks enabled by the clock gating during Sleep and Stop modes

Bit 12 SPI1SMEN : SPI1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SPI1 clocks disabled by the clock gating during Sleep and Stop modes

1: SPI1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 11 TIM1SMEN : TIM1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: TIM1 clocks disabled by the clock gating during Sleep and Stop modes

1: TIM1 clocks enabled by the clock gating during Sleep and Stop modes

Bits 10:0 Reserved, must be kept at reset value.

11.8.44 RCC APB3 peripheral clock enable in Sleep and Stop modes register (RCC_APB3SMENR)

Address offset: 0x0D0

Reset value: 0xFFFF FFFF

Access: no wait state; word, half-word, and byte access

This register only configures the clock gating, not the clock source itself. When a bit is set in Stop mode, the corresponding peripheral clock is enabled only when a peripheral (this one or another) requests the AHB or APB clock (refer to Section 11.4.24 ).

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.RTCAPBSMENVREFSMENRes.Res.Res.Res.
rwrw
1514131211109876543210
COMPSMENOPAMPSMENLPTIM4SMENLPTIM3SMENLPTIM1SMENRes.Res.Res.I2C3SMENLPUART1SMENSPI3SMENRes.Res.Res.SYSCFGSMENRes.
rwrwrwrwrwrwrwrwrw

Bits 31:22 Reserved, must be kept at reset value.

Bit 21 RTCAPBSMEN : RTC and TAMP APB clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: RTC and TAMP APB clock disabled by the clock gating during Sleep and Stop modes

1: RTC and TAMP APB clock enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 20 VREFSMEN : VREFBUF clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: VREFBUF clocks disabled by the clock gating during Sleep and Stop modes

1: VREFBUF clocks enabled by the clock gating during Sleep and Stop modes

Bits 19:16 Reserved, must be kept at reset value.

Bit 15 COMPSMEN : COMP clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: COMP clocks disabled by the clock gating during Sleep and Stop modes

1: COMP clocks enabled by the clock gating during Sleep and Stop modes

Bit 14 OPAMPSMEN : OPAMP clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: OPAMP clocks disabled by the clock gating during Sleep and Stop modes

1: OPAMP clocks enabled by the clock gating during Sleep and Stop modes

Bit 13 LPTIM4SMEN : LPTIM4 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: LPTIM4 clocks disabled by the clock gating during Sleep and Stop modes

1: LPTIM4 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 12 LPTIM3SMEN : LPTIM3 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: LPTIM3 clocks disabled by the clock gating during Sleep and Stop modes

1: LPTIM3 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 11 LPTIM1SMEN : LPTIM1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: LPTIM1 clocks disabled by the clock gating during Sleep and Stop modes

1: LPTIM1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bits 10:8 Reserved, must be kept at reset value.

Bit 7 I2C3SMEN : I2C3 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: I2C3 clocks disabled by the clock gating during Sleep and Stop modes

1: I2C3 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 6 LPUART1SMEN : LPUART1 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: LPUART1 clocks disabled by the clock gating during Sleep and Stop modes

1: LPUART1 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 5 SPI3SMEN : SPI3 clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SPI3 clocks disabled by the clock gating during Sleep and Stop modes

1: SPI3 clocks enabled by the clock gating during Sleep and Stop modes

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bits 4:2 Reserved, must be kept at reset value.

Bit 1 SYSCFGSMEN : SYSCFG clock enable during Sleep and Stop modes

This bit is set and cleared by software.

0: SYSCFG clocks disabled by the clock gating during Sleep and Stop modes

1: SYSCFG clocks enabled by the clock gating during Sleep and Stop modes

Bit 0 Reserved, must be kept at reset value.

11.8.45 RCC SmartRun domain peripheral autonomous mode register (RCC_SRDAMR)

Address offset: 0x0D8

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
SRAM4
AMEN
Res.ADF1A
MEN
LPDMA
1AMEN
DAC1A
MEN
LPGPI
O1AME
N
ADC4A
MEN
Res.Res.Res.RTCAP
BAME
N
VREFA
MEN
Res.Res.Res.Res.
rwrwrwrwrwrwrwrw
1514131211109876543210
COMP
AMEN
OPAMP
AMEN
LPTIM4
AMEN
LPTIM3
AMEN
LPTIM1
AMEN
Res.Res.Res.I2C3A
MEN
LPUAR
T1AME
N
SPI3A
MEN
Res.Res.Res.Res.Res.
rwrwrwrwrwrwrwrw

Bit 31 SRAM4AMEN : SRAM4 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: SRAM4 autonomous mode disabled during Stop 0/1/2 mode

1: SRAM4 autonomous mode enabled during Stop 0/1/2 mode

Bit 30 Reserved, must be kept at reset value.

Bit 29 ADF1AMEN : ADF1 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: ADF1 autonomous mode disabled during Stop 0/1/2 mode

1: ADF1 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 28 LPDMA1AMEN : LPDMA1 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: LPDMA1 autonomous mode disabled during Stop 0/1/2 mode

1: LPDMA1 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 27 DAC1AMEN : DAC1 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: DAC1 autonomous mode disabled during Stop 0/1/2 mode

1: DAC1 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 26 LPGPIO1AMEN : LPGPIO1 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: LPGPIO1 autonomous mode disabled during Stop 0/1/2 mode

1: LPGPIO1 autonomous mode enabled during Stop 0/1/2 mode

Bit 25 ADC4AMEN : ADC4 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: ADC4 autonomous mode disabled during Stop 0/1/2 mode

1: ADC4 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bits 24:22 Reserved, must be kept at reset value.

Bit 21 RTCAPBAMEN : RTC and TAMP autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: RTC and TAMP autonomous mode disabled during Stop 0/1/2 mode

1: RTC and TAMP autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 20 VREFAMEN : VREFBUF autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: VREFBUF autonomous mode disabled during Stop 0/1/2 mode

1: VREFBUF autonomous mode enabled during Stop 0/1/2 mode

Bits 19:16 Reserved, must be kept at reset value.

Bit 15 COMPAMEN : COMP autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: COMP autonomous mode disabled during Stop 0/1/2 mode

1: COMP autonomous mode enabled during Stop 0/1/2 mode

Bit 14 OPAMPAMEN : OPAMP autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: OPAMP autonomous mode disabled during Stop 0/1/2 mode

1: OPAMP autonomous mode enabled during Stop 0/1/2 mode

Bit 13 LPTIM4AMEN : LPTIM4 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: LPTIM4 autonomous mode disabled during Stop 0/1/2 mode

1: LPTIM4 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 12 LPTIM3AMEN : LPTIM3 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: LPTIM3 autonomous mode disabled during Stop 0/1/2 mode

1: LPTIM3 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 11 LPTIM1AMEN : LPTIM1 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: LPTIM1 autonomous mode disabled during Stop 0/1/2 mode

1: LPTIM1 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bits 10:8 Reserved, must be kept at reset value.

Bit 7 I2C3AMEN : I2C3 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: I2C3 autonomous mode disabled during Stop 0/1/2 mode

1: I2C3 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 6 LPUART1AMEN : LPUART1 autonomous mode enable in Stop 0/1/2 mode

This bit is set and cleared by software.

0: LPUART1 autonomous mode disabled during Stop 0/1/2 mode

1: LPUART1 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bit 5 SPI3AMEN : SPI3 autonomous mode enable in Stop 0,1, 2 mode

This bit is set and cleared by software.

0: SPI3 autonomous mode disabled during Stop 0/1/2 mode

1: SPI3 autonomous mode enabled during Stop 0/1/2 mode

Note: This bit must be set to allow the peripheral to wake up from Stop modes.

Bits 4:0 Reserved, must be kept at reset value.

11.8.46 RCC peripherals independent clock configuration register 1 (RCC_CCIPR1)

Address offset: 0x0E0

Reset value: 0x0000 0000

Access: no wait states; word, half-word, and byte access

31302928272625242322212019181716
TIMICSEL[2:0]Res.ICLKSEL[1:0]FDCAN1SEL[1:0]SYSTICKSEL[1:0]SPI1SEL[1:0]LPTIM2SEL[1:0]SPI2SEL[1:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrwrw
1514131211109876543210
I2C4SEL[1:0]I2C2SEL[1:0]I2C1SEL[1:0]UART5SEL[1:0]UART4SEL[1:0]USART3SEL[1:0]USART2SEL[1:0]USART1SEL[1:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:29 TIMICSEL[2:0] : Clock sources for TIM16,TIM17, and LPTIM2 internal input capture

When TIMICSEL2 is set, the TIM16, TIM17, and LPTIM2 internal input capture can be connected either to HSI/256, MSI/4, or MSI/1024. Depending on TIMICSEL[1:0] value, MSI is either MSIK or MSIS.

When TIMICSEL2 is cleared, the HSI, MSIK, and MSIS clock sources cannot be selected as TIM16, TIM17, or LPTIM2 internal input capture.

0xx: HSI, MSIK and MSIS dividers disabled

100: HSI/256, MSIS/1024 and MSIS/4 generated and can be selected by TIM16, TIM17, and LPTIM2 as internal input capture

101: HSI/256, MSIS/1024 and MSIK/4 generated and can be selected by TIM16, TIM17, and LPTIM2 as internal input capture

110: HSI/256, MSIK/1024 and MSIS/4 generated and can be selected by TIM16, TIM17, and LPTIM2 as internal input capture

111: HSI/256, MSIK/1024 and MSIK/4 generated and can be selected by TIM16, TIM17, and LPTIM2 as internal input capture

Note: The clock division must be disabled (TIMICSEL configured to 0xx) before selecting or changing a clock sources division.

Bit 28 Reserved, must be kept at reset value.

Bits 27:26 ICLKSEL[1:0] : Intermediate clock source selection

These bits are used to select the clock source for the OTG_FS, the USB, and the SDMMC.

00: HSI48 clock selected

01: PLL2 "Q" (pll2_q_ck) selected

10: PLL1 "Q" (pll1_q_ck) selected

11: MSIK clock selected

Bits 25:24 FDCAN1SEL[1:0] : FDCAN1 kernel clock source selection

These bits are used to select the FDCAN1 kernel clock source.

00: HSE clock selected

01: PLL1"Q" (pll1_q_ck) selected

10: PLL2"P" (pll2_p_ck) selected

11: reserved

Bits 23:22 SYSTICKSEL[1:0] : SysTick clock source selection

These bits are used to select the SysTick clock source.

00: HCLK/8 selected

01: LSI selected

10: LSE selected

11: reserved

Note: When LSE or LSI is selected, the AHB frequency must be at least four times higher than the LSI or LSE frequency. In addition, a jitter up to one HCLK cycle is introduced, due to the LSE or LSI sampling with HCLK in the SysTick circuitry.

Bits 21:20 SPI1SEL[1:0] : SPI1 kernel clock source selection

These bits are used to select the SPI1 kernel clock source.

00: PCLK2 selected

01: SYSCLK selected

10: HSI16 selected

11: MSIK selected

Note: The SPI1 is functional in Stop 0 and Stop 1 mode only when the kernel clock is HSI16 or MSIK.

Bits 19:18 LPTIM2SEL[1:0] : Low-power timer 2 kernel clock source selection

These bits are used to select the LPTIM2 kernel clock source.

00: PCLK1 selected

01: LSI selected

10: HSI16 selected

11: LSE selected

Note: The LPTIM2 is functional in Stop 0 and Stop 1 mode only when the kernel clock is LSI, LSE or HSI16 if HSIKERON = 1.

Bits 17:16 SPI2SEL[1:0] : SPI2 kernel clock source selection

These bits are used to select the SPI2 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: MSIK selected

Note: The SPI2 is functional in Stop 0 and Stop 1 mode only when the kernel clock is HSI16 or MSIK.

Bits 15:14 I2C4SEL[1:0] : I2C4 kernel clock source selection

These bits are used to select the I2C4 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: MSIK selected

Note: The I2C4 is functional in Stop 0 and Stop 1 modes only when the kernel clock is HSI16 or MSIK.

Bits 13:12 I2C2SEL[1:0] : I2C2 kernel clock source selection

These bits are used to select the I2C2 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: MSIK selected

Note: The I2C2 is functional in Stop 0 and Stop 1 mode only when the kernel clock is HSI16 or MSIK.

Bits 11:10 I2C1SEL[1:0] : I2C1 kernel clock source selection

These bits are used to select the I2C1 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: MSIK selected

Note: The I2C1 is functional in Stop 0 and Stop 1 mode only when the kernel clock is HSI16 or MSIK.

Bits 9:8 UART5SEL[1:0] : UART5 kernel clock source selection

These bits are used to select the UART5 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: LSE selected

Note: The UART5 is functional in Stop 0 and Stop 1 modes only when the kernel clock is HSI16 or LSE.

Bits 7:6 UART4SEL[1:0] : UART4 kernel clock source selection

These bits are used to select the UART4 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: LSE selected

Note: The UART4 is functional in Stop 0 and Stop 1 modes only when the kernel clock is HSI16 or LSE.

Bits 5:4 USART3SEL[1:0] : USART3 kernel clock source selection

These bits are used to select the USART3 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: LSE selected

Note: The USART3 is functional in Stop 0 and Stop 1 modes only when the kernel clock is HSI16 or LSE.

Bits 3:2 USART2SEL[1:0] : USART2 kernel clock source selection

These bits are used to select the USART2 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: LSE selected

Note: The USART2 is functional in Stop 0 and Stop 1 modes only when the kernel clock is HSI16 or LSE.

This bitfield is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bitfield as reserved and keep it at reset value.

Bits 1:0 USART1SEL[1:0] : USART1 kernel clock source selection

These bits are used to select the USART1 kernel clock source.

00: PCLK2 selected

01: SYSCLK selected

10: HSI16 selected

11: LSE selected

Note: The USART1 is functional in Stop 0 and Stop 1 modes only when the kernel clock is HSI16 or LSE.

11.8.47 RCC peripherals independent clock configuration register 2 (RCC_CCIPR2)

Address offset: 0x0E4

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
OTGHSSEL[1:0]Res.I2C6SEL[1:0]I2C5SEL[1:0]HSPI1SEL[1:0]OCTOSPISEL[1:0]Res.LTDCS ELUSART6SEL[1:0]
rwrwrwrwrwrwrwrwrwrwrwrwrw

1514131211109876543210
DSISELSDMMCSELRNGSEL[1:0]SAESS ELSAI2SEL[2:0]SAI1SEL[2:0]Res.Res.MDF1SEL[2:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:30 OTGHSSEL[1:0] : OTG_HS PHY kernel clock source selection

These bits are used to select the OTG_HS PHY kernel clock source.

00: HSE selected

01: PLL1 “P” (pll1_p_ck) selected. If selecting this option, then only HSE input should be selected in PLL1SRC.

10: HSE/2 selected

11: PLL1 “P” divided by 2 (pll1_p_ck/2) selected. If selecting this option, then only HSE input should be selected in PLL1SRC.

Note: This bitfield is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bitfield as reserved and keep it at reset value.

Bits 29:28 Reserved, must be kept at reset value.

Bits 27:26 I2C6SEL[1:0] : I2C6 kernel clock source selection

These bits are used to select the I2C6 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: MSIK selected

Note: The I2C6 is functional in Stop 0 and Stop 1 modes only when the kernel clock is HSI16 or MSIK.

This bitfield is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bitfield as reserved and keep it at reset value.

Bits 25:24 I2C5SEL[1:0] : I2C5 kernel clock source selection

These bits are used to select the I2C5 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: MSIK selected

Note: The I2C5 is functional in Stop 0 and Stop 1 modes only when the kernel clock is HSI16 or MSIK.

This bitfield is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bitfield as reserved and keep it at reset value.

Bits 23:22 HSPI1SEL[1:0] : HSPI1 kernel clock source selection

These bits are used to select the HSPI1 kernel clock source.

00: SYSCLK selected

01: PLL1 "Q" (pll1_q_ck) selected, can be up to 200 MHz

10: PLL2 "Q" (pll2_q_ck) selected, can be up to 200 MHz

11: PLL3 "R" (pll3_r_ck) selected, can be up to 200 MHz

Note: This bitfield is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bitfield as reserved and keep it at reset value.

Bits 21:20 OCTOSPISEL[1:0] : OCTOSPI1 and OCTOSPI2 kernel clock source selection

These bits are used to select the OCTOSPI1 and OCTOSPI2 kernel clock source.

00: SYSCLK selected

01: MSIK selected

10: PLL1 "Q" (pll1_q_ck) selected, can be up to 200 MHz

11: PLL2 "Q" (pll2_q_ck) selected, can be up to 200 MHz

Bit 19 Reserved, must be kept at reset value.

Bit 18 LTDCSEL : LTDC kernel clock source selection

This bit is used to select the LTDC kernel clock source.

0: PLL3 "R" (pll3_r_ck) selected

1: PLL2 "R" (pll2_r_ck) selected

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 17:16 USART6SEL[1:0] : USART6 kernel clock source selection

These bits are used to select the USART6 kernel clock source.

00: PCLK1 selected

01: SYSCLK selected

10: HSI16 selected

11: LSE selected

Note: The USART6 is functional in Stop 0 and Stop 1 modes only when the kernel clock is HSI16 or LSE.

This bitfield is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bitfield as reserved and keep it at reset value.

Bit 15 DSISEL : DSI kernel clock source selection

This bit is used to select the DSI kernel clock source.

0: PLL3 "P" (pll3_p_ck) selected

1: DSI PHY PLL output selected

Note: This bit is only available on some devices in the STM32U5 Series.

Refer to the device datasheet for availability of its associated peripheral.

If not present, consider this bit as reserved and keep it at reset value.

Bit 14 SDMMCSEL : SDMMC1 and SDMMC2 kernel clock source selection

This bit is used to select the SDMMC kernel clock source. It is recommended to change it only after reset and before enabling the SDMMC.

0: ICLK clock selected

1: PLL1 "P" (pll1_p_ck) selected, in case higher than 48 MHz is needed (for SDR50 mode)

Bits 13:12 RNGSEL[1:0] : RNG kernel clock source selection

These bits are used to select the RNG kernel clock source.

00: HSI48 selected

01: HSI48 / 2 selected, can be used in range 4

10: HSI16 selected

11: reserved

Bit 11 SAESSEL : SAES kernel clock source selection

This bit is used to select the SAES kernel clock source.

0: SHSI selected

1: SHSI / 2 selected, can be used in range 4

Note: This bit is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bit as reserved and keep it at reset value.

Bits 10:8 SAI2SEL[2:0] : SAI2 kernel clock source selection

These bits are used to select the SAI2 kernel clock source.

000: PLL2 "P" (pll2_p_ck) selected

001: PLL3 "P" (pll3_p_ck) selected

010: PLL1 "P" (pll1_p_ck) selected

011: input pin AUDIOCLK selected

100: HSI16 clock selected

others: reserved

Note: If the selected clock is the external clock and this clock is stopped, a switch to another clock is impossible.

This bitfield is only available on some devices in the STM32U5 Series. Refer to the device datasheet for availability of its associated peripheral. If not present, consider this bitfield as reserved and keep it at reset value.

Bits 7:5 SAI1SEL[2:0] : SAI1 kernel clock source selection

These bits are used to select the SAI1 kernel clock source.

000: PLL2 "P" (pll2_p_ck) selected

001: PLL3 "P" (pll3_p_ck) selected

010: PLL1 "P" (pll1_p_ck) selected

011: input pin AUDIOCLK selected

100: HSI16 clock selected

others: reserved

Note: If the selected clock is the external clock and this clock is stopped, a switch to another clock is impossible.

Bits 4:3 Reserved, must be kept at reset value.

Bits 2:0 MDF1SEL[2:0] : MDF1 kernel clock source selection

These bits are used to select the MDF1 kernel clock source.

000: HCLK selected

001: PLL1 "P" (pll1_p_ck) selected

010: PLL3 "Q" (pll3_q_ck) selected

011: input pin AUDIOCLK selected

100: MSIK clock selected

others: reserved

11.8.48 RCC peripherals independent clock configuration register 3 (RCC_CCIPR3)

Address offset: 0x0E8

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.ADF1SEL[2:0]
rwrwrw
1514131211109876543210
DAC1SELADCDACSEL[2:0]LPTIM1SEL[1:0]LPTIM34SEL[1:0]I2C3SEL[1:0]Res.SPI3SEL[1:0]LPUART1SEL[2:0]
rwrwrwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:19 Reserved, must be kept at reset value.

Bits 18:16 ADF1SEL[2:0] : ADF1 kernel clock source selection

These bits are used to select the ADF1 kernel clock source.

000: HCLK selected

001: PLL1 "P" (pll1_p_ck) selected

010: PLL3 "Q" (pll3_q_ck) selected

011: input pin AUDIOCLK selected

100: MSIK clock selected

others: reserved

Note: The ADF1 is functional in Stop 0, Stop 1, and Stop 2 modes only when the kernel clock is AUDIOCLK or MSIK.

Bit 15 DAC1SEL : DAC1 sample-and-hold clock source selection

This bit is used to select the DAC1 sample-and-hold clock source.

0: LSE selected

1: LSI selected

Bits 14:12 ADCDACSEL[2:0] : ADC1, ADC2, ADC4 and DAC1 kernel clock source selection

These bits are used to select the ADC1, ADC2, ADC4, and DAC1 kernel clock source.

000: HCLK clock selected

001: SYSCLK selected

010: PLL2 "R" (pll2_r_ck) selected

011: HSE clock selected

100: HSI16 clock selected

101: MSIK clock selected

others: reserved

Note: The ADC1, ADC2, ADC4, and DAC1 are functional in Stop 0, Stop 1, and Stop 2 modes only when the kernel clock is HSI16 or MSIK (only ADC4 and DAC1 are functional in Stop 2 mode).

Bits 11:10 LPTIM1SEL[1:0] : LPTIM1 kernel clock source selection

These bits are used to select the LPTIM1 kernel clock source.

00: MSIK clock selected

01: LSI selected

10: HSI16 selected

11: LSE selected

Note: The LPTIM1 is functional in Stop 0, Stop 1, and Stop 2 modes only when the kernel clock is LSI, LSE, HSI16 with HSIKERON = 1, or MSIK with MSIKERON = 1.

Bits 9:8 LPTIM34SEL[1:0] : LPTIM3 and LPTIM4 kernel clock source selection

These bits are used to select the LPTIM3 and LPTIM4 kernel clock source.

00: MSIK clock selected

01: LSI selected

10: HSI selected

11: LSE selected

Note: The LPTIM3 and LPTIM4 are functional in Stop 0, Stop 1, and Stop 2 modes only when the kernel clock is LSI, LSE, HSI16 with HSIKERON = 1, or MSIK with MSIKERON = 1.

Bits 7:6 I2C3SEL[1:0] : I2C3 kernel clock source selection

These bits are used to select the I2C3 kernel clock source.

00: PCLK3 selected

01: SYSCLK selected

10: HSI16 selected

11: MSIK selected

Note: The I2C3 is functional in Stop 0, Stop 1, and Stop 2 modes only when the kernel clock is HSI16 or MSIK.

Bit 5 Reserved, must be kept at reset value.

Bits 4:3 SPI3SEL[1:0] : SPI3 kernel clock source selection

These bits are used to select the SPI3 kernel clock source.

00: PCLK3 selected

01: SYSCLK selected

10: HSI16 selected

11: MSIK selected

Note: The SPI3 is functional in Stop 0, Stop 1, and Stop 2 modes only when the kernel clock is HSI16 or MSIK.

Bits 2:0 LPUART1SEL[2:0] : LPUART1 kernel clock source selection

These bits are used to select the LPUART1 kernel clock source.

000: PCLK3 selected

001: SYSCLK selected

010: HSI16 selected

011: LSE selected

100: MSIK selected

others: reserved

Note: The LPUART1 is functional in Stop 0, Stop 1, and Stop 2 modes only when the kernel clock is HSI16, LSE, or MSIK.

11.8.49 RCC backup domain control register (RCC_BDCR)

Address offset: 0x00F0

Backup domain reset value: 0x0000 0000 (for STM32U575/585)

Backup domain reset value: 0x0000 X000 (for the other STM32U5 Series devices)

Reset by backup domain reset, except LSCOSEL, LSCOEN, and BDRST that are reset only by backup domain power-on reset, and LSESYSEN and LSESYSDY that are reset by power-on reset.

Access: 0 ≤ wait state ≤ 3; word, half-word, and byte access

Wait states are inserted in case of successive accesses to this register.

Note: These register bits are outside of the core domain. After reset, these bits are then write-protected, and DBP must be set in PWR_BDCR1 before these can be modified (see Section 10: Power control (PWR) for further information). Any internal or external reset does not have any effect on these bits.

31302928272625242322212019181716
Res.Res.Res.LSIPREDIVLSIRDYLSIONLSCOSELLSCOENRes.Res.Res.Res.Res.Res.Res.BDRST
rwrwrwrwrwrw

1514131211109876543210
RTCCENRes.Res.LSEGOONLSESYSDYRes.RTCSEL[1:0]LSESYSENLSECS SDLSECS SONLSEDRV[1:0]LSEBY PLSERDYLSEON
rwrwrrwrwrwrrwrwrwrrw

Bits 31:29 Reserved, must be kept at reset value.

Bit 28 LSIPREDIV : Low-speed clock divider configuration

This bit is set and cleared by software to enable the LSI division. It can be written only when the LSI is disabled (LSION = 0 and LSIRDY = 0). If the LSI was previously enabled, it is necessary to wait for at least 60 µs after clearing LSION bit (synchronization time for LSI to be really disabled), before writing LSIPREDIV. The LSIPREDIV cannot be changed if the LSI is used by the IWDG or by the RTC.

0: LSI not divided

1: LSI divided by 128

Bit 27 LSIRDY : LSI oscillator ready

This bit is set and cleared by hardware to indicate when the LSI oscillator is stable. After LSION is cleared, LSIRDY goes low after three internal low-speed oscillator clock cycles. This bit is set when the LSI is used by IWDG or RTC, even if LSION = 0.

0: LSI oscillator not ready

1: LSI oscillator ready

Bit 26 LSION : LSI oscillator enable

This bit is set and cleared by software. The LSI oscillator is disabled 60 µs maximum after the LSION bit is cleared.

0: LSI oscillator OFF

1: LSI oscillator ON

Bit 25 LSCOSEL : Low-speed clock output selection

This bit is set and cleared by software.

0: LSI clock selected

1: LSE clock selected

Bit 24 LSCOEN : Low-speed clock output (LSCO) enable

This bit is set and cleared by software.

0: LSCO disabled

1: LSCO enabled

Bits 23:17 Reserved, must be kept at reset value.

Bit 16 BDRST : Backup domain software reset

This bit is set and cleared by software.

0: Reset not activated

1: Reset the entire backup domain.

Bit 15 RTCEN : RTC and TAMP clock enable

This bit is set and cleared by software.

0: RTC and TAMP clock disabled

1: RTC and TAMP clock enabled

Bits 14:13 Reserved, must be kept at reset value.

Bit 12 LSEGFON : LSE clock glitch filter enable

This bit is set and cleared by hardware to enable the LSE glitch filter. It can be written only when the LSE is disabled (LSEON = 0 and LSERDY = 0).

0: LSE glitch filter disabled

1: LSE glitch filter enabled

Bit 11 LSESYSRDY : LSE system clock (LSESYS) ready

This bit is set and cleared by hardware to indicate when the LSE system clock is stable. When LSESYSEN is set, this LSESYSRDY flag is set after two LSE clock cycles. The LSE clock must be already enabled and stable (LSEON and LSERDY are set). When the LSEON bit is cleared, LSERDY goes low after six external low-speed oscillator clock cycles.

0: LSESYS clock not ready

1: LSESYS clock ready

Bit 10 Reserved, must be kept at reset value.

Bits 9:8 RTCSEL[1:0]: RTC and TAMP clock source selection

This bit is set by software to select the clock source for the RTC and TAMP. Once the RTC and TAMP clock source has been selected, it cannot be changed anymore unless the backup domain is reset, or unless a failure is detected on LSE (LSECSSD is set). BDRST bit can be used to reset them.

Bit 7 LSESYSEN: LSE system clock (LSESYSEN) enable

This bit is set by software to enable always the LSE system clock generated by RCC, which can be used by any peripheral when its source clock is the LSE, or at system level if one of LSCOSEL, MCO, or MSI PLL mode is needed.

Bit 6 LSECSSD: CSS on LSE failure detection

This bit is set by hardware to indicate when a failure is detected by the CSS on the external 32 kHz oscillator (LSE).

Bit 5 LSECSSON: CSS on LSE enable

This bit is set by software to enable the CSS on LSE. It must be enabled after the LSE oscillator is enabled (LSEON bit enabled) and ready (LSERDY flag set by hardware), and after the RTCSEL bit is selected.

Once enabled, this bit cannot be disabled, except after a LSE failure detection (LSECSSD = 1). In that case, the software must disable this LSECSSON bit.

Bits 4:3 LSEDRV[1:0]: LSE oscillator drive capability

This bitfield is set by software to modulate the drive capability of the LSE oscillator. It can be written only when the external 32 kHz oscillator is disabled (LSEON = 0 and LSERDY = 0).

Note: The oscillator is in 'Xtal mode' when it is not in bypass mode.

Bit 2 LSEBYP: LSE oscillator bypass

This bit is set and cleared by software to bypass oscillator in debug mode. It can be written only when the external 32 kHz oscillator is disabled (LSEON = 0 and LSERDY = 0).

Bit 1 LSERDY: LSE oscillator ready

This bit is set and cleared by hardware to indicate when the external 32 kHz oscillator is stable. After LSEON is cleared, this LSERDY bit goes low after six external low-speed oscillator clock cycles.

Bit 0 LSEON : LSE oscillator enable
This bit is set and cleared by software.
0: LSE oscillator off
1: LSE oscillator on

11.8.50 RCC control/status register (RCC_CSR)

Address offset: 0x0F4
Reset value: 0x0C00 4400
Reset by system reset, except reset flags by power reset only.
Access: \( 0 \le \text{wait state} \le 3 \) ; word, half-word, and byte access
Wait states are inserted in case of successive accesses to this register.

31302928272625242322212019181716
LPWR
RSTF
WWDG
RSTF
IWDGR
STF
SFTRS
TF
BORR
STF
PINRS
TF
OBLRS
TF
Res.RMVFRes.Res.Res.Res.Res.Res.Res.
rrrrrrrrw
1514131211109876543210
MSISSRANGE[3:0]MSIKSRANGE[3:0]Res.Res.Res.Res.Res.Res.Res.Res.
rwrw

Bit 31 LPWRRSTF : Low-power reset flag

This bit is set by hardware when a reset occurs due to a Stop, Standby, or Shutdown mode entry, whereas the corresponding NRST_STOP, NRST_STBY, or NRST_SHDW option bit is cleared. This bit is cleared by writing to the RMVF bit.
0: No illegal low-power mode reset occurred
1: Illegal low-power mode reset occurred

Bit 30 WWDGRSTF : Window watchdog reset flag

This bit is set by hardware when a window watchdog reset occurs. It is cleared by writing to the RMVF bit.
0: No window watchdog reset occurred
1: Window watchdog reset occurred

Bit 29 IWDGRSTF : Independent watchdog reset flag

This bit is set by hardware when an independent watchdog reset domain occurs. It is cleared by writing to the RMVF bit.
0: No independent watchdog reset occurred
1: Independent watchdog reset occurred

Bit 28 SFTRSTF : Software reset flag

This bit is set by hardware when a software reset occurs. It is cleared by writing to RMVF.
0: No software reset occurred
1: Software reset occurred

Bit 27 BORRSTF : Brownout reset or an exit from Shutdown mode reset flag

This bit is set by hardware when a brownout reset or an exit from Shutdown mode reset occurs. It is cleared by writing to the RMVF bit.
0: No BOR/exit from Shutdown mode reset occurred
1: BOR/exit from Shutdown mode reset occurred

Bit 26 PINRSTF : NRST pin reset flag

This bit is set by hardware when a reset from the NRST pin occurs. It is cleared by writing to the RMVF bit.

0: No reset from NRST pin occurred

1: Reset from NRST pin occurred

Bit 25 OBLRSTF : Option-byte loader reset flag

This bit is set by hardware when a reset from the option-byte loading occurs. It is cleared by writing to the RMVF bit.

0: No reset from option-byte loading occurred

1: Reset from option-byte loading occurred

Bit 24 Reserved, must be kept at reset value.

Bit 23 RMVF : Remove reset flag

This bit is set by software to clear the reset flags.

0: No effect

1: Clear the reset flags.

Bits 22:16 Reserved, must be kept at reset value.

Bits 15:12 MSISSRANGE[3:0] : MSIS range after Standby mode

This bitfield is set by software to choose the MSIS frequency at startup. It is used after exiting Standby mode until MSIRGSEL is set. After a NRST pin or a power-on reset or when exiting Shutdown mode, the range is always 4 MHz. MSISSRANGE can be written only when MSIRGSEL = 1.

0100: range 4 around 4M Hz (reset value)

0101: range 5 around 2 MHz

0110: range 6 around 1.33 MHz

0111: range 7 around 1 MHz

1000: range 8 around 3.072 MHz

others: reserved

Note: Changing this bitfield does not change the current MSIS frequency.

Bits 11:8 MSIKSRANGE[3:0] : MSIK range after Standby mode

This bit is set by software to choose the MSIK frequency at startup. It is used after exiting Standby mode until MSIRGSEL is set. After a NRST pin or a power-on reset or when exiting Shutdown mode, the range is always 4 MHz. MSIKSRANGE can be written only when MSIRGSEL = 1.

0100: range 4 around 4M Hz (reset value)

0101: range 5 around 2 MHz

0110: range 6 around 1.33 MHz

0111: range 7 around 1 MHz

1000: range 8 around 3.072 MHz

others: reserved

Note: Changing this bitfield does not change the current MSIK frequency.

Bits 7:0 Reserved, must be kept at reset value.

11.8.51 RCC secure configuration register (RCC_SECCFGR)

Address offset: 0x110

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

When the system is secure (TZEN = 1), this register can be written only by a secure privileged access if SPRIV = 1, and by a secure privileged or unprivileged access if SPRIV = 0. A nonsecure write access generates an illegal access event and data is not written. This register can be read by secure or nonsecure, privilege or unprivileged access. When the system is not secure (TZEN = 0), this register is read as 0, and the register write is ignored.

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.RMVFS
EC
HSI48S
EC
ICLK
S
EC
PLL3S
EC
PLL2S
EC
PLL1S
EC
PRESC
SEC
SYSCL
KSEC
LSESE
C
LSISE
C
MSISE
C
HSESE
C
HSISE
C
rwrwrwrwrwrwrwrwrwrwrwrwrw

Bits 31:13 Reserved, must be kept at reset value.

Bit 12 RMVFSEC : Remove reset flag security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 11 HSI48SEC : HSI48 clock configuration and status bit security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 10 ICLKSEC : Intermediate clock source selection security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 9 PLL3SEC : PLL3 clock configuration and status bit security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 8 PLL2SEC : PLL2 clock configuration and status bit security

Set and reset by software.

0: nonsecure

1: secure

Bit 7 PLL1SEC : PLL1 clock configuration and status bit security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 6 PRESCSEC : AHBx/APBx prescaler configuration bits security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 5 SYSCLKSEC : SYSCLK clock selection, STOPWUCK bit, clock output on MCO configuration security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 4 LSESEC : LSE clock configuration and status bit security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 3 LSISEC : LSI clock configuration and status bit security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 2 MSISEC : MSI clock configuration and status bit security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 1 HSESEC : HSE clock configuration bits, status bit and HSE_CSS security

This bit is set and reset by software.

0: nonsecure

1: secure

Bit 0 HSISEC : HSI clock configuration and status bit security

This bit is set and reset by software.

0: nonsecure

1: secure

11.8.52 RCC privilege configuration register (RCC_PRIVCFGGR)

Address offset: 0x114

Reset value: 0x0000 0000

Access: no wait state; word, half-word, and byte access

This register can be written only by a privileged access. It can be read by privileged or unprivileged access.

31302928272625242322212019181716
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
1514131211109876543210
Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.NSPRI
V
SPRIV
rwrw

Bits 31:2 Reserved, must be kept at reset value.

Bit 1 NSPRIV : RCC nonsecure function privilege configuration

This bit is set and reset by software. It can be written only by privileged access, secure or nonsecure.
0: Read and write to RCC nonsecure functions can be done by privileged or unprivileged access.
1: Read and write to RCC nonsecure functions can be done by privileged access only.

Bit 0 SPRIV : RCC secure function privilege configuration

This bit is set and reset by software. It can be written only by a secure privileged access.
0: Read and write to RCC secure functions can be done by privileged or unprivileged access.
1: Read and write to RCC secure functions can be done by privileged access only.

11.8.53 RCC register map

Table 119. RCC register map and reset values

OffsetRegister name313029282726252423222120191817161514131211109876543210
0x000RCC_CRRes.Res.PLL3RDYPLL3ONPLL2RDYPLL2ONPLL1RDYPLL1ONRes.Res.Res.HSEEXTCSSONHSEBYPHSERDYHSEONSHSIRDYSHSIONHSI48RDYHSI48ONRes.HSIRDYHSIKERONHSIONMSIPLLFASTMSIPLLSELMSIKRDYMSIKONMSIPLLENMSISRDYMSIKERONMSISON
Reset value00000000000000000000110101
0x004ReservedReserved
0x008RCC_ICSCR1MSISRANGE [3:0]MSIKRANGE [3:0]MSIRGSELMSIBIASRes.MSICAL0[4:0]MSICAL1[4:0]MSICAL2[4:0]MSICAL3[4:0]
Reset value0100010000XXXXXXXXXXXXXXXXXXXXX
0x00CRCC_ICSCR2Res.MSITRIM0[4:0]MSITRIM1[4:0]MSITRIM2[4:0]MSITRIM3[4:0]
Reset value10000100001000010000
0x010RCC_ICSCR3Res.HSITRIM[4:0]Res.HSICAL[11:0]
Reset value10000XXXXXXXXXXXX
0x014RCC_CRRCRRes.HSI48CAL[8:0]
Reset valueXXXXXXXXX
0x018ReservedReserved
0x01CRCC_CFGR1Res.MCOPRE [2:0]MCOSEL [3:0]Res.STOPKERWUCKSTOPWUCKSWS[1:0]SW[1:0]
Reset value0000000000000
0x020RCC_CFGR2Res.APB2DISAPB1DISAHB2DIS2AHB2DIS1AHB1DISDPRE[2:0]PPRE2 [2:0]Res.PPRE1 [2:0]HPRE[3:0]
Reset value000001100000000000
0x024RCC_CFGR3Res.APB3DISAHB3DISRes.PPRE3 [2:0]Res.
Reset value00000

Table 119. RCC register map and reset values (continued)

OffsetRegister name313029282726252423222120191817161514131211109876543210
0x028RCC_PLL1CFGRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.PLL1RENPLL1QENPLL1PENRes.PLL1MBOOST [3:0]PLL1M[3:0]Res.Res.Res.PLL1FRACENPLL1RGE[1:0]PLL1SRC[1:0]
Reset value000000000000000
0x02CRCC_PLL2CFGRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.PLL2RENPLL2QENPLL2PENRes.Res.Res.Res.PLL2M[3:0]Res.Res.Res.PLL2FRACENPLL2RGE[1:0]PLL2SRC[1:0]
Reset value000000000000
0x030RCC_PLL3CFGRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.PLL3RENPLL3QENPLL3PENRes.Res.Res.Res.PLL3M[3:0]Res.Res.Res.PLL3FRACENPLL3RGE[1:0]PLL3SRC[1:0]
Reset value000000000000
0x034RCC_PLL1DIVRRes.PLL1R[6:0]Res.PLL1Q[6:0]PLL1P[6:0]PLL1N[8:0]
Reset value00100010000010000001010000000
0x038RCC_PLL1FRACRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.PLL1FRACN[12:0]Res.Res.Res.
Reset value0000000000000
0x03CRCC_PLL2DIVRRes.PLL2R[6:0]Res.PLL2Q[6:0]PLL2P[6:0]PLL2N[8:0]
Reset value00100010000010000001010000000
0x040RCC_PLL2FRACRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.PLL2FRACN[12:0]Res.Res.Res.
Reset value0000000000000
0x044RCC_PLL3DIVRRes.PLL3R[6:0]Res.PLL3Q[6:0]PLL3P[6:0]PLL3N[8:0]
Reset value00100010000010000001010000000
0x048RCC_PLL3FRACRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.PLL3FRACN[12:0]Res.Res.Res.
Reset value0000000000000
0x04CReservedReserved
0x050RCC_CIERRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.SHSIRDYIEMSIKRDYIERes.Res.PLL3RDYIEPLL2RDYIEPLL1RDYIEHSI48RDYIEHSERDYIEHSIRDYIEMSISRDYIELSERDYIELSIRDYIE
Reset value00000000000
0x054RCC_CIFRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.SHSIRDYFMSIKRDYFCSSFRes.PLL3RDYFPLL2RDYFPLL1RDYFHSI48RDYFHSERDYFHSIRDYFMSISRDYFLSERDYFLSIRDYF
Reset value000000000000
Table 119. RCC register map and reset values (continued)
OffsetRegister name313029282726252423222120191817161514131211109876543210
0x058RCC_CICRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.SHSIRDYCMSIKRDYCCSSCRes.Res.PLL3RDYCPLL2RDYCPLL1RDYCHSI48RDYCHSERDYCHSIRDYCMSISRDYCLSERDYCLSIRDYC
Reset value000000000000
0x05CReservedReserved
0x060RCC_AHB1RSTRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.GPU2DRSTGFXMMURSTDMA2DRSTRAMCFGRSTTSCRSTJPEGRSTRes.Res.CRCRSTRes.Res.Res.Res.Res.Res.Res.Res.Res.MDF1IRSTFMACRSTCORDICRSTGPDMA1RST
Reset value00000000000
0x064RCC_AHB2RSTR1Res.Res.Res.SDMMC2RSTSDMMC1RSTRes.Res.OTFDEC2RSTOTFDEC1RSTRes.OCTOSPIMRSTSAESRSTPKARSTRNGRSTHASHRSTAESRSTRes.OTGRSTRes.DCMI_PSSIRSTRes.ADC12RSTGPIOJRSTGPIOIRSTGPIOHRSTGPIOGRSTGPIOFRSTGPIOERSTGPIODRSTGPIOCRSTGPIOBRSTGPIOARST
Reset value00000000000000000000000
0x068RCC_AHB2RSTR2Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.HSPI1RSTRes.Res.Res.OCTOSPI2RSTRes.Res.Res.Res.Res.OCTOSPI1RSTRes.Res.FSMCRST
Reset value0000
0x06CRCC_AHB3RSTRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.ADF1RSTLPDMA1RSTRes.Res.Res.DAC1RSTADC4RSTRes.Res.Res.Res.LPGPIO1RST
Reset value00000
0x070ReservedReserved
0x074RCC_APB1RSTR1Res.Res.Res.Res.Res.Res.Res.USART6RSTCRSRSTRes.I2C2RSTI2C1RSTUART5RSTUART4RSTUSART3RSTUSART2RSTRes.Res.SPI2RSTRes.Res.Res.Res.Res.Res.Res.Res.Res.TIM7RSTTIM6RSTTIM5RSTTIM4RSTTIM3RSTTIM2RST
Reset value000000000000000
0x078RCC_APB1RSTR2Res.Res.Res.Res.Res.Res.Res.Res.Res.UCPD1RSTRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.FDCAN1RSTRes.Res.I2C6RSTI2C5RSTLPTIM2RSTRes.Res.Res.Res.I2C4RSTRes.
Reset value000000
0x07CRCC_APB2RSTRRes.Res.Res.Res.DSIRSTLTDCIRSTGFXTIMRSTUSBRSTRes.SAI2RSTSAI1RSTRes.Res.Res.TIM17RSTTIM16RSTTIM15RSTRes.USART1RSTTIM8RSTSPI1RSTTIM1RSTRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
Reset value0000000000000

Table 119. RCC register map and reset values (continued)

OffsetRegister name313029282726252423222120191817161514131211109876543210
0x080RCC_APB3RSTRResResResResResResResResResResResVREFRSTResResResResCOMPRSTOPAMP_RSTLPTIM4RSTLPTIM3RSTLPTIM1RSTResResResResI2C3RSTLPUART1RSTSPI3RSTResResResSYSCFGRST
Reset value000000000
0x084ReservedReserved
0x088RCC_AHB1ENRSRAM1ENDCACHE1ENResBKPSRAMENResResResGTZC1ENResResDCACHE2ENGPU2DENGFXMMUENDMA2DENRAMCFGENTSCENJPEGENResResCRCENResResResFLASHENResResResResMDF1ENFMACENCORDICENGPDMA1EN
Reset value11101000000010000
0x08CRCC_AHB2ENR1SRAM3ENSRAM2ENResSDMMC2ENSDMMC1ENResResOTFDEC2ENOTFDEC1ENResOCTOSPIMENSAESENPKAENRNGENHASHENAESENOTGHS PHYENOTGENResDCMI_PSS1ENResADC12ENGPIOJENGPIOIENGPIOHENGPIOGENGPIOFENGPIOEENGPIODENGPIOCENGPIOBENGPIOAEN
Reset value1100000000000000000000000
0x090RCC_AHB2ENR2SRAM5ENSRAM0ENResResResResResResResResResResResResResResResResResHSP11ENResResResResResResResResResResResFSMCMEN
Reset value1100
0x094RCC_AHB3ENRSRAM4ENResResResResResResResResResResResResResResResResResResGTZC2ENResADF1ENLPDMA1ENResResDAC1ENADC4ENResResPWRENResLPGPIO1EN
Reset value10000000
0x098ReservedReserved
0x09CRCC_APB1ENR1ResResResResResResUSART6ENCRSENResI2C2ENI2C1ENUART3ENUART4ENUSART3ENUSART2ENResResSPI2ENResResResWWDGENResResResResResTIM7ENTIM6ENTIM5ENTIM4ENTIM3ENTIM2EN
Reset value0000000000000000
0x0A0RCC_APB1ENR2ResResResResResResResResUCPD1ENResResResResResResResResResResResResResResResResResResResResResResRes
Reset value0
0x0A4RCC_APB2ENRResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResRes
Reset value0000000000000000000000000000
0x0A8RCC_APB3ENRResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResRes
Reset value
0x0ACReservedReserved

Table 119. RCC register map and reset values (continued)

OffsetRegister name313029282726252423222120191817161514131211109876543210
0x0B0RCC_AHB1SMENRSRAM1SMENDCACHE1SMENICACHE1SMENBKPSRAMSMENRes.Res.Res.GTZC1SMENRes.Res.DCACHE2SMENGPU2DSMENGFXTMUSMENDMA2DSMENRAMCFGSMENTSCSMENJPEGSMENRes.Res.CRCSMENRes.Res.Res.FLASHSMENRes.Res.Res.Res.Res.MDF1SMENFMACSMENCORDICSMENGPDMA1SMEN
Reset value111111111111111111
0x0B4RCC_AHB2SMENR1SRAM3SMENSRAM2SMENRes.SDMMC2SMENSDMMC1SMENRes.Res.OTFDEC2SMENOTFDEC1SMENRes.OCTOSPIMSMENSAESSMENPKASMENRNGSMENHASHSMENAESSMENOTGHSPHYSMENOTGSMENRes.DCMI_PSSISMENRes.ADC12SMENGPIOJSMENGPIOISMENGPIOHSMENGPIOGSMENGPIOFSMENGPIOESMENGPIO DSMENGPIOCSMENGPIOBSMENGPIOASMEN
Reset value11111111111111111111111111
0x0B8RCC_AHB2SMENR2SRAM5SMENSRAM6SMENRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.HSPI1SMENRes.Res.Res.OCTOSP12SMENRes.Res.Res.Res.Res.Res.Res.Res.FSMCSMEN
Reset value11111
0x0BCRCC_AHB3SMENRSRAM4SMENRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.GTZC2SMENRes.ADF1SMENLPDMA1SMENRes.Res.DAC1SMENADC4SMENRes.Res.PWRSMENRes.LPGPIO1SMEN
Reset value11111111
0x0C0ReservedReserved
0x0C4RCC_APB1SMENR1Res.Res.Res.Res.Res.Res.USART6SMENCRSSMENRes.I2C2SMENI2C1SMENUART5SMENUART4SMENUSART3SMENUSART2SMENRes.Res.SPI2SMENRes.Res.WWDGSMENRes.Res.Res.Res.Res.Res.Res.TIM7SMENTIM6SMENTIM5SMENTIM4SMEN
Reset value11111111111111
0x0C8RCC_APB1SMENR2Res.Res.Res.Res.Res.Res.Res.Res.UCPD1SMENRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.FDCAN1SMENRes.Res.I2C6SMENI2C5SMENLPTIM2SMENRes.Res.Res.I2C4SMEN
Reset value111111
0x0CCRCC_APB2SMENRRes.Res.Res.Res.DSISMENLTDCCSMENGFXTIMSMENUSBMSMENRes.SAI2SMENSAI1SMENRes.Res.TIM17SMENTIM16SMENTIM15SMENRes.USART1SMENTIM8SMENSPI1SMENTIM1SMENRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.Res.
Reset value1111111111111
0x0D0RCC_APB3SMENRRes.Res.Res.Res.Res.Res.Res.Res.Res.Res.RTCAPBSMENVREFSMENRes.Res.Res.Res.COMPSMENOPAMPSMENLPTIM4SMENLPTIM3SMENLPTIM1SMENRes.Res.Res.Res.I2C3SMENLPUART1SMENSPI3SMENRes.Res.Res.SYSCFGSMEN
Reset value11111111111
0x0D4ReservedReserved

Table 119. RCC register map and reset values (continued)

OffsetRegister name313029282726252423222120191817161514131211109876543210
0x0D8RCC_SRDRAMRSRAM4AMENResADF1AMENLPDMA1AMENDAC1AMENLPGPIO1AMENADC4AMENResResResRTCAPBAMENVREFAMENResResResResCOMPAMENOPAMPAMENLPTIM4AMENLPTIM3AMENLPTIM1AMENResResResI2C3AMENLPUART1AMENSPI3AMENResResResResRes
Reset value0000000000000000
0x0E0RCC_CCIPR1TIM1CSEL [2:0]ResResResICLKSEL [1:0]FDICANSEL [1:0]SYSTICKSELResResResSPI1SEL [1:0]LPTIM2SEL [1:0]ResResResResI2C4SEL [1:0]I2C2SEL [1:0]I2C1SEL [1:0]UART5SEL [1:0]UART4SEL [1:0]USART3SEL [1:0]ResResResUSART2SEL [1:0]USART1SEL [1:0]ResResResRes
Reset value000000000000000000000000000
0x0E4RCC_CCIPR2OTGHSSEL [1:0]ResResResI2C6SEL [1:0]I2C5SEL [1:0]HSP1SEL [1:0]OCTOSPSEL [1:0]ResResResResResResResResDSISELSDMMCSELRNGSEL [1:0]SAESSELSAI2SEL [2:0]SAI1SEL [2:0]ResResResResResResMDF1SEL [2:0]ResResRes
Reset value00000000000000000000000000000
0x0E8RCC_CCIPR3ResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResRes
Reset value
0x0F0RCC_BDCRResResResLSIPREDIVLSIRDYLSIONLSCOSELLSCOENResResResResResResResResResResResResResResResResResResResResResResResRes
Reset value00000
0x0F4RCC_CSRLPWRRSTFWWDGRSTFWDGRSTFSFTRSTFBORRSTFPINRSTFOBLRSTFRMVFResResResResResResResResResResResResResResResResResResResResResResResRes
Reset value00001100
0x0F8-0x10CReservedReserved
0x110RCC_SECCFGRResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResRes
Reset value
0x114RCC_PRIVCFGRResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResResRes
Reset value
Refer to Section 2.3 for the register boundary addresses.